KEGG   Rhincodon typus (whale shark): 109925046Help
Entry
109925046         CDS       T06055                                 

Definition
(RefSeq) erlin-2-B-like
  KO
K23341  erlin
Organism
rtp  Rhincodon typus (whale shark)
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rtp04121]
    109925046
Ubiquitin system [BR:rtp04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    109925046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 Catalase-rel
Motif
Other DBs
NCBI-GeneID: 109925046
NCBI-ProteinID: XP_020380615
Position
Unknown
AA seq 340 aa AA seqDB search
MAQLGSVVAVAAAILAAMIFSSVHKVEEGHIAVYYRGGALLKATSGPGFHLMLPFITTFK
TVQNTVQTDEVKNVPCGTSGGVMIYFDRIEVVNFLIPSAVYDIVRNYTADYDKTLIFNKI
HHELNQFCSVHTLQEVYIELFDRIDEDLKLALQQDLTAMAPGLIIHAVRVTKPNIPETIR
RNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEIKFAQMIMEKETEK
RISEIEDGIFVAREKARADADFYTAQQVAEANRLKLSPEYLQLLKYRAIASNSKIYFGKD
IPKMFVDLSAFTPGAVSKTSEEVNTAPEIDSMLKEFEGRL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctcggctctgtcgtggcagttgctgctgccattcttgctgccatgatcttc
tcgtctgtacacaaggtggaagagggtcacatcgctgtttactataggggtggagcatta
ttaaaggcaacgagtggtccgggattccatctcatgctgccctttatcaccactttcaaa
actgtacagaataccgtccagacagatgaagtaaaaaatgtcccttgtggtacaagcggt
ggagtcatgatatactttgacaggatcgaagtggtgaatttcctcattccaagtgcagtg
tatgacattgtgagaaactacacggcagactacgacaagacattgatttttaacaagatc
caccatgagctgaaccagttctgcagcgttcacactctacaggaagtctacattgaactg
ttcgatcggatagatgaggacctgaagttggcactgcagcaagatttaacagccatggct
ccgggtctgattatccacgcagtccgggtgaccaaacccaacattccagaaaccatccgc
aggaactatgaattaatggagagtgagaagacaaaattactgatcgcagcacagaaacaa
aaggtggtagagaaggaagccgagactgaacggaaaaaagcgctcatcgaggcagagaag
gtagctcaagtggctgagattaaatttgcccagatgataatggagaaggaaacggagaag
aggatctccgagattgaagatggtatctttgttgcacgggagaaggctcgagcagacgct
gatttctacacggcccagcaagtggctgaagccaaccggctgaagctgagccctgaatat
ctgcagcttctgaaatatcgagcaattgcttccaacagcaaaatctacttcgggaaggac
atccccaagatgtttgtggacttgagtgcctttacacctggagcagtgagcaaaacatca
gaggaagtgaacacagcgcctgagattgacagcatgctgaaggagtttgaaggcaggcta
taa

DBGET integrated database retrieval system