KEGG   Rhincodon typus (whale shark): 109926593Help
Entry
109926593         CDS       T06055                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: carnitine O-palmitoyltransferase 1, liver isoform-like
Organism
rtp  Rhincodon typus (whale shark)
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 109926593
NCBI-ProteinID: XP_020382016
Position
Unknown
AA seq 181 aa AA seqDB search
MGQSAIPMCSSQYERMFNSTRLPGLETDTLQHLKDSKHIAVYHRGRFYKVWLYHNGRLLN
PREIQTQMQKILDDQSPAQPGEEKLAALTAGDRVPWAKARRSFFSQGKNKVSLDTIEKAA
FFVTLDDTEQGFRKEDPMTSLDSYAKSLLHGKCYDRSVTGMELEVTKQGENLGLGPQKAV
G
NT seq 544 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaagtgcaatccccatgtgttcctcccagtacgagcgtatgttcaattccacc
cgcctcccggggttagagacagacactctgcagcacttgaaggacagcaaacacatagcc
gtctaccaccggggacgtttctacaaggtctggctctatcacaatggcaggcttctcaac
ccccgtgagatccaaactcagatgcagaagatcctcgatgaccagtcaccagcccagcct
ggggaggagaaactggcagcactgactgcaggagacagggtcccctgggctaaagcacgt
aggtcattcttcagccagggcaagaacaaggtgtcattggacaccatcgagaaagctgct
ttctttgtgacactggatgacaccgagcagggattcaggaaggaggatcccatgacatcc
ctcgatagttacgccaagtctctccttcacggcaagtgctacgacaggtcagtgactgga
atggagttggaggtgaccaagcagggtgagaacctaggcctggggccacagaaggccgtg
gggg

DBGET integrated database retrieval system