KEGG   Rhincodon typus (whale shark): 109926600
Entry
109926600         CDS       T06055                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp00100  Steroid biosynthesis
rtp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    109926600
Enzymes [BR:rtp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     109926600
SSDB
Motif
Pfam: ERG4_ERG24 DUF347
Other DBs
NCBI-GeneID: 109926600
NCBI-ProteinID: XP_020382025
Position
Unknown
AA seq 235 aa
MSDADWSGPGSPRSDWMVRSTLLAADWLSVCRHVMPVGSDWLGSNGYSQGNRLAGGAAMD
DKVKTQRTQELEFGGPLGALILLALLPCTVLLLLLSCRSEAASVFSLPSPLPPLTELWDL
GSFLLVLAWFGLQAALYMLPLGQVTEGMPLRDGTRLSYRLNGLQAFAITSLLVGAGVAFG
VLQLSAVYNGCVQLAVAAAVSSLVLAVFLYARSLCMPESALAPGGNSGESSIRPA
NT seq 705 nt   +upstreamnt  +downstreamnt
atgtcggacgctgattggtcgggccccggcagcccacgctccgattggatggtccggtcc
acgctgctggctgccgattggctgtccgtctgtcgccatgtgatgcctgtgggatccgat
tggctcgggtcgaatggatacagtcagggcaaccggctggcgggaggagcagccatggac
gacaaggtgaaaacgcagaggacccaggagctggaatttggaggacctctcggcgcgctg
atcctcctggcactgctgccttgtaccgtcctgctcctgctgctctcctgtcgctctgag
gcagcgagtgtcttcagtctgccgtctcccctgccacccctgaccgagctctgggacctg
ggctccttcctgctggttctggcctggttcggcctgcaggctgcgctctacatgctcccc
cttggccaggtcacggaaggcatgcctcttcgggatggcacaagactctcctatcgcctt
aacgggctccaggcctttgccatcacctccctcctggttggggccggagtggcctttggg
gtcctgcagctgagtgcggtctataacgggtgcgtacagctggccgtcgccgctgccgtc
tcttcgctcgtgctggccgtcttcctgtatgcccgctcgctctgtatgcccgagtcagca
ctggctcctggcggaaactcaggtgagtcgtccattcggcccgct

DBGET integrated database retrieval system