KEGG   Rhincodon typus (whale shark): 109927237Help
Entry
109927237         CDS       T06055                                 

Gene name
ttn
Definition
(RefSeq) LOW QUALITY PROTEIN: titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
rtp  Rhincodon typus (whale shark)
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rtp01001]
    109927237 (ttn)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rtp04131]
    109927237 (ttn)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rtp04812]
    109927237 (ttn)
   04147 Exosome [BR:rtp04147]
    109927237 (ttn)
Enzymes [BR:rtp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109927237 (ttn)
Protein kinases [BR:rtp01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   109927237 (ttn)
Membrane trafficking [BR:rtp04131]
 Others
  Actin-binding proteins
   Others
    109927237 (ttn)
Cytoskeleton proteins [BR:rtp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     109927237 (ttn)
Exosome [BR:rtp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109927237 (ttn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 V-set C1-set C2-set_2 Ig_6 Receptor_2B4 Adeno_E3_CR1 Ig_C17orf99 Ig_4 Titin_Z THB
Motif
Other DBs
NCBI-GeneID: 109927237
NCBI-ProteinID: XP_020382789
Position
Unknown
AA seq 11162 aa AA seqDB search
MATQAPTFLHPLQSVVALEGSAATFEAHISGLPVPEVSWFRDGQVLSAAALPGAEISFSD
GRAKLIISRVTPSHSGRYSVRATNGSGQATSTAELLVTAETAPPNFIQRLQSMTAKQGSK
VRLDVRVTGIPTPVVKFYREGAEIQSSPDFQIVQDGDLYSLIIAEVYVEDSGTFSVTATN
SVGRATSTAELRIQADEVVPAKKTKTIITSTDISQARQIQVEKKMEAHYEASASATEMIV
DGRTVVQHLHHKTPPRIPPKPMSRSPTPPPSGVKVTRQQSPSPVRHVRVPAPSPVRSVSP
AGRLSTSPIRSVKSPVLTRKSQTTAVVTSEVIPPWKQQDYVSATEAQKRESKLIASSAQV
HREEKWERRYGVHGQMIISGVDGAAGAARMTAVERAAGAGAVGITTVDGGVSAARMTAVE
RAAGAGAVGITTVDGGVSAARMTAVERAAGAGAVGITTVDGGVSAARMTAVERAAGAGAV
GITTVDGGVSAARMTAVERAAGAGAVGITTVDGGVSAARMTAVEREAGAAGATRITKVEQ
VTGAPRTTTVERVTRVTTIEGAAGAAGVAAVEGSAAAVGVSSVAGKETAHDIEKTAAVAT
VVAAVDQARVREPVTVSATTERSTSEKHVFTVQAHLVEDQIEIGKKAEAVATVLAAVDQA
RTRHPLYAEGVHSEEASMEYEYAQRGVSQSTTEFSAERRTVPAEQHVVTTTVRKGTVIVP
TETQISYGEQAEKHISQIERAAESAVHLDHKVSSTIPHFTVSKITVAKPETTQEVSIAGT
AIVTLEKELAASSAVKVTKPVKPPVLKEARVVTEESVSLQPRFRERTDVYETRFDTEMRK
HLGLSISGSLEADFDVEHEEEYEAEDEEPAPLPVPAAVPLTAPSFVSGLKNMTVVEGESV
TLSCEITGHPAPTVMWFREDYHIESSIDFHITFEKGIASITIREAFAEDSGRFTCTATND
AGTASSSCYLLVQVSEEIESREETFAVSEQAVHERKRVEMKVETLSGTSITPESVEEGAG
VAPFFIRKPIVQKLIEGGSVIFDCQIGGTPKPHVYWRKAGIPLTTGYRYKVSYNREMGEC
KLEISMTFADDAGEYSVVVRNKHGEISASTQLLEEADYELYMKEHEEITERTEIVTEYVQ
EPKVAEVAPTIFMTEYEKEQALIRKKMGKSAAMMKTVTEEQEYHISSFEERLIKEIELRI
IRITLEELLEEDGEEMVIDIPAEESIAPGFDSTLKSFRVLDGSGITFHCKVSGYPLPKVV
WFKDGKRLKHGQHYQMDISQDGRANLRIATVLPEDEGIYTVFASNVKGNAICSGKLFIEP
IGTPTGHAYLPTTEIMRRMRSVSPRSPSRSPARRLEDTDETQLERLYKPVFVLKPTSFKC
SEGQTARFDLKVVGRPMPETLWFHNGRQIVNDYTHKIVVKEDGIQSLIIVPALPIDSGEW
TVVAQNRAGKSSVSMTLSVEAKEHLLRPQFVEKLKNLSVKEGAPVAMAVKAVGNPNPDIV
WLKNSDIIAQHKYPHIKIEGTKGEGALKIASAANYDAAWYTATAINKAGRDTTRCKLNVE
LEFAEPEPERKLIIPKGTYKAKEISAPELEPLHLRYGQEQWEEGDLYDKEKQQKPHFKKK
TSSVRLKCFGPAHFECRLTPIGDPTMVVEWLLDSKPLAAANRLRMINEFGYCSLDFEVAY
PRDSGIITCRATNKYGTDQTSATLIVKDEKSLVEESQLPEGRRGMQRIEELERLAHEGAL
TGLAEELIKEKTKPEIVLFPEPARVMEGEIARYRCRVVGYPQPKVNWYLNGQLIRKSKRF
RLRYDGIYYLEIIDCKSYDSGNIKVTAENPEGVVEHTVKLEITEREDFRSILRRAPEQKV
DIGPPEPAKPFFEVIKIEKPADAATKEVVKLKKAERIVHEKQTEETEELRSKFKRRQEEG
YYEAITAVELKSRRKDEAYEEMLRKRKEELLHWTKEVPEEEKKPLPPQGTITIPTFKPDK
IKLSPSMEAPKILERIQSQTVSRGDESHFRVRVVGKPDPECQWFKNGVKLEKSDRIYWYW
PEDNVCELVIRDVVPEDSASIMVKAINVAGEISSHAFLLVQAKQVITFSEEMHDVNAKEK
DTMATFECELSEPFIKVEWFKNNVQIFSGDKYRMHSDRKVHLLSVLTIGMNDAAEYTCAL
VDDPSIRSTAKLIVEGALVEFTKELADLEVPELFSGELECAVSNEDAEGKWYKGDVEIQP
SSKYYISSRRGRHTLTVKDVIKEDQGRYSFVVEGKKTSCNLKMKPRAVTILQDLEDQTIC
EGDIAQLEVKFSQENVEGVWKKDGQEIEANERVHIVIDKTSHMLLIEDATIKDAGRYSFH
ATDLDLVTSGRLIVQSIDIVIPLKDVTVIEGTKAVLECKVSVAHITSVKWYFNDQPIQLG
DRIQAIAKGAKQRLVISKSFASDEGCYKLVIGKTETSCNLSIERIHIIRGLKDGTCTETQ
SVTFEAELSHSGIDVGWVFRKQGLKTGPKYKIEAKGKIYRLTVLNIMKDEEGEYTFTAGE
KTSKATLTVSGGAISKPLKDQTVPESQPTVFECMVANADSEGIWSKDGKPITFGNIIRSE
VDGVTRRLIIDITKSEDAAEYSYQVANSKTSAKLKVEAVKIKKTLKNQTVTETHDAVFTL
ELTHPDVTRSQWIKNGEEIKPSDKYEITVDGVIHTLRIKKCVTSDESVYNFKLGRLSANA
RLHVEVIKVIKKPKDITAMENATATFELSVSHDNVPVKWMFNNVELKTSDKCKVIAQRKV
HKLVLENVTPAQVGEYSAIIGQLECKAKLYVESVHITKTMKNVEVPETKNATFQCEVSHF
NVPSTWLKNGVEIEMSDKFKVVVQGKLHQLIIMNTSNEDSAEYTFICGNNKVSATLTVKP
ILITSMLKDMNAQEKDTITFEVTVNYEGITYKWLKNGKEIKSTERTQIKTKQLTHTLSIR
NIHFGDAAEYSFVAGSASSAATLYVEARHIEFRKHIKDIKVTEKKKATFECEVSEPNIEI
QWMKDGAELQPSERIKMHSEKFIHRLTIPVTKMADAGQYAAVVGENISTANLYVEARHIV
ISKPVHADIQVIEKKKAIFEFEVDEDDVEAQWLKDGTEINFQVEERYRYIIQRRVHRMTI
TETKVSDSGEYTFVAGRNRSSMKLLVNVLEPPSFKLELEPCVVKAGEPARFCAVIVGTPK
LEVSWFKDDQKLSSGFKRKLLHDENQYTLLLIEAFPEDAGTYKCEARNEVGLAASGASLD
VEVPEVVSPEVEAPVYPPTIISPIQDTSTTEGKSAQFQCRVTGTDLKVTWYSKQKEIKQS
RFFKMVQFEDTYQLEIAEVYPEDEGIYKCVASNSVGEVSCTANLKLEDYKVQSIDSQSIT
TSGKAVDESIVSKTFEVSKMHVESPVTITHTKNYAKEISLQQEHTYNVQMFESVSMNSSS
KTVSSERWEECQKIAHTETIRSGYQCPPKILQDMNNVPVLLGETASLKCQVLAFPRPEIK
WYREGQELVAVKRIKIVTITEDEVLTSSELIIREVQEKDTGTYRCKALNLYGEVKCEAEI
TVTAAKPALEVPMILLELSDLRVKAGQVAQFICSFSGQSFSEVIWSQRSKRLEESERLKI
SQNGNVMSLTILNVHLEDQGQYSCTARNEGGEMKTTAVLIVEAEESKPKTGAKIPTDSNS
DSTKTEQRPHITSDSKLEVLTKPSSPPPSSTKRPIRREKPRSHDYYPDIVPFDELIDTGA
IAPMFLEKLPPEVIVQNGEDVLLFCLVKGVPSPCVLWLYNQRIVEESSLCSIKHDGLLCS
LKLQKVSRSHSGTYSCKAVNSAGETACNTLLRVTAPKIQDKIEQQIEMEVREFSSSVTIA
AEDEREDFYSSELHVSDKTFELKPETATLSSTLEITTDAKPLQTVPVFIKXISSIEVVVE
DVAKFSVTVTGFPKPSIQWFCNSKKLTPSSNYKFVYDRDEYSLIIPYAKFTDEGEYSCSA
TNILGETSCSAYLKIKPKEGFRKSSAKPPLAKLADRKMPVMPTEIIHPPRGQPPHFFQEL
KSLQCPEGLPAIFEYVVIGEPIPEVFWYKENNQIHQSLHCSLSSNSDGSGSLTINKAQKE
DSGLYSCKAFNQFGETTCTAELTVFSGTFATTEHTKEEVAHKHHTQTYKKSVSDHATESR
LFMVTLPGDAQAELQDRDQLVYTIASEDKHSVHSEQTGMLHEVTVSAAEATIAGKSQIVM
HSQTTQESLGYIEQHYEPIKSPPILELSSTEVRLDTALRLPTVEEQTVIPKESSFSIRDS
PTITAKTKRKEVSILSEEKRLIPSSRTSTLDIVEQEISKTEPAYPLHRYKIEGHQEPPKE
ALFAFEIPDGQKCEIQRERKMEVHTAVATENKRVRHEMTKDIQTLDAARKAKLSKELPKP
FLTSVTESQKSLPKESLFEVQKGDIQQASLMKDKFVKTALTTEEKQQLMGEHADIIIGLD
SAISITSKKEVKKPLHLQIVQGQDTLPKETTFTFEVPTEEKADTRRSPTLLHSLLSEEQH
LIPEEHTTPLSDAKDTTIIKPTKEHMPIFCPHSVMTACILHKEDLLPYEKPATHMAGHRL
EKAYSYAAVIEEKPELLAEQTKMLEMEIKSSKAEAKTELLPREFLPSVTVPMHIAKEKML
TIEGKEQRAIINKLDDTVKQFSTITENKVVEDGSVAMFEGLDAASCEDKYESKLPSISVQ
VKEKAVAIESTTMLEAAEKDFAARIQQGQSVRFPLLLQEKHLIEEEHSSAITRSEKKVLK
VERQXKEKLLTHVIQESEVLQKEKALNIEVPQASTLDVGVQIRKALQSALASEQCVLSSI
SLGGVEEVEIKELKVQKEPACILYTYQITNVNPPIDITLSFEGEYPQKADLRKELTAAFH
AITHEQQRAFLAEQLDTIRPPTDVLEKLHISITPAKEIFSPEAVTISESTFEAGMHVAEQ
KLQTNITVSQDYSVISKKAAVQEMTTTTESEGFTQDFKSVETVEEVTIVSHKRDVGGTII
TTDAPPAPVPMEQSTEILKKEKEMEEIIVTHISKPRKLGETPIKPPKDKPVIVKGLTDIT
VDEDSEVKLSTVITKVNKVNWYINGKRITSKNEFKCLQERDTYSLIINKVQKEEHQGEYV
CEALNEAGKATTSAKLTVIIRVPPSFKRKIESLEVIVGQPTQFECEVDPIPDVRFQWFRA
RAELRDSEKYSIVTEKYTSILKLLKPQLIDCGDYTCRASNRCGSVSSTAKLIVTELTPPS
FITRLQSVTTFVGKTAKLQCAVAGSPVIHTTWQKNGVDITDEENYKISVKDNKRILEIRD
LKVQNKGTYSCKVTNDCGTDICSADLTILDKPHFTKTLEPTQTILNCGTHLECQVDEDTA
VKISWKKDGIELHAGKDYKITFEDKTAVLEILKTKLKDAGNYVCTASNEAGSNSCSAALT
VKEPPSFLKKLEPTLLLKQGDSAHLKCQVKGSPEINVTWYKNNKVLHSSEKFKISFVDST
TVLEINNLNVEDSGDYVCEAQNEAGTDTCSSVVTIKEPPSFSKAFEPTEVVKGFGCTLEC
ELSGTAPFEVLWHKDRKPIRTSRKYKMVSQDAHVSLHVSFFESSDVGDYQCTVSNELGKC
VCGATVKLKEPPSFVKKIENTTALLGSSAIFQCSIKGSPPITLTWLKDKDVVTESNNVKM
TYENNISTLQIAAVEMNNGGKYACIAENEAGSQKCLATLVVKEPANILEKAEPISVTAGD
PATLEFTVAGTPELKIKWFRNGKELISSRKYKMTFSKNVASLRIISAESEDSGEYSFEVK
NDVGSCSCKTFINVLDRMIAPSFTKKLRKMTSILGATFHMECKFSGSMPVSVYWYKDDKE
LTASDKYRILCQDNTATLTVDQLEIADGGTYYCKVTNPAGSDECSGVLSIKEPPSFIMKP
ASEHVLPGSTVKFKTVVNGTPPMSMKWFKDNTELVTGGTCFIMKDISTTYLEIFSAKPSD
KGDYICEISNDAGVISCSTNLFVKEPPVFLRKPEPSKLLKKREDKQIHPSEKYRISFVDS
VAILEILEGDVEDSGEYSCEAKNEVASERCSVSVTIKEPPSFRKELESLKVLKTSDIILE
CEVAEPANIIEKAESISVTVGEPATLDCSFTGTPEIKARWFKDGTELVTGRKYKISVTNK
VTSLKIRTTEKEDSGEYTCEVANDVGSSSCKASVTILDRIVPPSFKRNLKNMDGMKTSFV
KMECKIAGSLPMSVLWYKDNQEIIANEKYKFSYHDNTAQLEIHQLEMADGGTYVCRAINA
AGTDQSSGVLTVKEPAQFIKKPERTMSLQKGGSVRLECTVTGTPEIKVTWYKKESVIHPS
DKIRMSFVDSVSFFELIDASVEDSGHYTCRAENEAGFDICNVIVAIKEPPSVRKKLEPVE
VVKGNDINLECEVDGTGPLDVTWYKDNKQIRASIKFKMFIGKSLFSLSVQKADNSDVGEY
KCEVTNDVGSCSCVTGVRLKEPPSFVKKIENITILSQSAASFTSQIQGSSPILVTWMKDK
DEIREDDHIKISFENNIATLQIASVGASDSGKYTCQAINDAGTEKCFATLSVTEPAQIIE
KPQSLSVTSGAAAILECVVAGTPELKVRWLKNETELTSSRKYKMTFVNKAAILRVLSVTK
EDSGEYVFEVQNEFGQSSCKTTLTVLDRIIAPSFSRSLKKMDGILGTLMHMECKVSGSLP
IDIVWYKDNKEIFTGPKYKISFEENTALLEIKELELTDGGNYSCKATNTAGVSECSGFLT
VKEPPSFVQEPVSQAIVLGATMQFKSVVKGTLPLIVKWFKDNRELRPSPRCSIWNEETTH
YFELNSAKISDAGVYSCHLSNKAGSVTSTAEVFIKEPPSFVKKPAPSAALKQGEFARFEC
KITGTPEITVTWYKNNTEIRTSDKYRTSFQNTVAVLEITDASVEDSGEYSCEAQNEVGGN
SCNFLVQVKEPPTFIKKLEPVDVVKSDDVTLECEVTGTAPFEVTWYKDNKPIRRGKKCKI
IFENSLASLTILKSDTPDVGEYTCTIKNDVGSCSCSSTVSLKEPPGFVKKIESVTTLSGN
SVVFQCVVKGSKPIYVTWMKDKDDVKEDGNISLPFENNIATLQISTVGENHAGKYTCHIK
NEAGTEKCSATLLVAEPAKIIEQAQSLSVTAGNPANLECTVAGTPELKVKCLKDGNEMVP
SRKYKLSFENNVISLKIPSVSNDDTAEYTFEVKNEFGTSICKASLTVLEPPSFVEKPVAQ
EALPGSTVQFRSVVKGTAPLSIKWLKDGRELMSGADCSILSEGSTSLLELFSAKVSDLGD
YTCEVSNKVGTATCTARLFVKEPPYFVKKLDPAAIFKKGETANFECKVTGTPEIKISWFK
NYQEISANQKYRMSFVDSVANLEIANISLEDDGIYSCKAQNEAGSKSCEMKVTVKEPPTF
TKKLEPVEVVKSTDVTLECEVAGSSPFEVMWYKDNKQIRRSKKYKIISDISLASLCILTS
DSSDIGEYTCTVKNDVGSCSCSSTVSLKEPPGFLKKIENMTTVSGNSVVFQCLVKGSKPI
YVTWMKDKDYIKEDGNISLSFENNIATLQINTVGENHAGKYTCHIKNDAGTEKCFATLLV
AEPAKIIEQAQPLSVTAGNPANLECTVAGTPELKVKCLKDGNEMVPSKRHKLSFENNVIS
LKIPSVSNDDTAEYTFEVKNEFGTSICKASLTVLDQIIPPVFTRKLRELDAILGSFVHME
CKASGSLPMSFTWYKDFTVITSDEKHKILSQDNATMLEVNELEFSDHGTYICKATNSAGS
DECSGILKVTEPPSFVEKPVAQEALPGSTVQFRSVVKGTAPLSIKWLKDGRELMSGADCF
ILNEGSTSLLELLSAKVSDLGDYTCEVSNKVGTATCTARLFVKEPPYFIEKLEPAAIFKK
GETAVFECKVTGTPEIKVSWFRDYQEISASEKCRMSFVDSVAILAIVDINLDDSGNYSCK
AQNEAGSESCEIKVTVKEPPTFTKKLEPVEVVKSTDVTLECEVAGSGPFEVIWYKDNKQI
RHSKKYKIITDISLASLCILKSDSSDVGEYKCTVKNDVGSCSCSSTVSFKEPANVKDKAE
PLTVTAGNPAILECTVAGTPELSVAWFKNGKQLESVGKYKMSFANKVASLKIQSVEMDDS
ADYTFKVQNEFGADSCSISLTVLEQIIAPLFTRKLKETSSTLGSFVQMECKIAGSIPMDI
SWYKDGNEISASNKYKMVFQDNMLSLEVFELDVSDGGRYSCRAANSAGKDECSAFLSVKE
PPSFVDKITSRDVVLGSTVQFRSVVKGTTPLSTKWLKGDRELMHGVAYSIWSEGSTYFLE
LVSAKISDAGSYTCQVSNDVEPPSFIKKLNPSTIIKKGDAARFECIITGTPKMKVTWYKG
GHELLASDKCVMSFDGSVAVLEIINVSLDDSTCYICEARNEAGSDSSSTEVEVKEPPSFR
RKLQSAEVIRNSGVTLECEVAGTAPFKVMWYKDNKQIRSSEKYKMVTENYSISLHMLKIG
PSFVGEYKCRVTNDVGSCSCSCGVSLKEPPSFIKKIENIIVVAGNPATFQCHVKGSHPLS
ITWMKNNDDIKEDDNLAISFENNIATLQIKAGDSKYSGKYMCQAKNDAGIEKCFATLIVT
EPAKIVERAKSHSVTAKNPANLECTVAGTPDLKVKWLKDGKEVTSSRNCKLSFEKNVASI
TILSVEKSSSGEYTFEVQNEYGVDSCKAFLTVLDQQIAPTFTKKLKDMGIALGSSMYMEC
KVSGSFPISIHWYKDGNEISDSNKYKISQQDNSSTLEMNQLEIADGGIYTCRVTNVAGSD
KCSATLVVKEPPRFIIKPKSQEVPPNSAVQFKSDVKGTPPLSFKWFKDDKELNSDATCCI
MAEGSSSSLQLYSVKHSSTGYYTCHVTNDVGTNTCTAKLFVTEPPSFIQKLEPSKVLKKG
ESAHFECKVTGTPEIKVSWFKNDHEISADNKYKMRFDKSVAVLEIIHADLEDSGDYICEA
QNEAGSASCNVAFTVKEPPVFXKTLETINAIKGSDVVQQCEISGTSPFEITWYKDKRQIR
ASKKYKITYENHVASIHILKVETPDIGEYMCVVKNDVGGDTCIGTLNLKEPPVFVKKLSN
ISSVLGESITLQATIKGSEPIHVTWIKEKEEVKVDEYMTTSYEQNTVTLHIAKMEAVHAG
KYVCQIKNDAGMQECIATVSLLEPATIVEKAESVSVNAGDPATLECIVRGSPELRVKWLK
DGHELASGRKYQISFINGISNLKILSAEKADSGQYTFEVQNNVGSSSCKXSVSVLDRIIP
PKFTRKLKKVNGILASPIQMECKVSGSPPIALAWFKDRQEIVHGAKYQLTFGDNTCGLKI
STLELSDAGNYTCKATNAAGSDECSGVLTVKEPPSFISKPDSQEVSPGSNVKFTSIVTGT
DPLKVSWFKGTTELVAGRQCHISLRDSTAVLELLNVESSQSGDYICQVSNEAGKVSCTTK
LFVKEPAVFQKKLKDSSVVLGKSVCLDCTYTGTPEIKVTWKKNGLAIFQSDKHILTTTET
SCILEILNCTRDDDAKYSCEVENDAGMDTCHAEVKVLEPPTFVQHLEPLEITLGDPGFFE
CRLAGTPEIKVSWYKGDTKLRATPNCKIEFVNNIARLELKKTTLSDSGEFICKAENKIGT
CSSKAMLTIQERKIAPSFTRKMQGMEGTLHLPVTFECHISGSTPIETTWFKDGVKLTSDE
NVLISFIGNVATLKILKAEMHHAGEYTCKATNMVGDASCSSRLTLKEARVAPVFDKKLEP
IKVITGQSVELECHVTGSSPIKVIWLKDGKEIRSNMNYKISFVENTPHLTILKADKGDSC
QYICEASNDLGRDSTQTQVTVKDRKIPPSFTKRPLEQIQDAEGKAIKLEGRVSGSQPISV
TWFKDDQEILQTENYELSFKNNVVTLNIKKAHLTDSAVYTCKASNEAGTAIFTVSVLITE
FIAPPVWDIPLKPMTITEGESLQFSCHVHGSKPIKIQWFKDRKEMKPSERLNFTFKDGTA
ALECKTCTKTDSGDYLCKATNEAGSVFCKAKLTVQEKAVAKKVVSPPKTDKIFFIEKPKS
VKITEKSIATFTAKVGGDPIPNVKWMKGKWRQINHGGRIIVQQKGQEAKLEIKDTVKTDS
GQYRCVASNKFGEIESSVNLEIEEKKEIIVETDFRAKLKKTPSKQKEEEADKDIDIVELL
RNVDPKEYEKYARMYGITDFRGLLQAIEQLKASKLEERERGPEEEEFNELIQYIQQRIEK
VEPIELTKDIEDQLVRTNADAVFECVIKINYPEIKLSWYKGTEKLESNDKYEISIDGDIH
CLKIKNCTLQDQGNFRIVCGPHISSAKLTVVEPIVEQHLENLSGKEGHICIMVCQFSLPN
LKTEWFRNGRRIEGQGRYSXDVADKLQKVTISDLRPEDQGRFTCKYEDLETSADLLVEAQ
PIEFTKTIQDIVVKEHESAVFECEVSFDDAIVTWFKDTVVLKESPKYSFRSDGRRHFMTI
HNVTTEDEGVYSVIAQLEPRGEAKSTAELYVSSQEITLKPRKPGKEWAEEIVAEKYEISE
DISYTILEEEEHGRWKVYNNNNVFEVSGVGKISIPEKVPEPAAPPRLSIEQEPVPRKEPT
KRIIEEVEQVTVSRKEVVPPKKVPXVPEPLPEEKKPIIRKEKVPPTKDVAEKPTPEEPVP
VQRKEKITTVKVTEITKKPTVEEVKPTIVPRKEKVAPAKVPEVPKKPIHEEIITVRREDI
IPTEVLEISEKTFVEEVKVITTTTKEEIFPPPVPEFIQKTLPEEVKLVSVPTKDIIPPKV
PEICEKPAVEEVKPAIIPEKAEITPAKVPKVPKKPLAEEMKPARLPGKEPVTPVKVPEVP
KKAPVEEIKLITPPRKEEAPPAKVPEVPKKPIKPEEKPTIVPRDKVAPTKVLEIPKKPAD
IEAQPVTILRKEEVITVTVPEVPKQAVAEEFKPAAVPRKEDAITVEVLEVPKKPVAKQVQ
PIEISREKVTPIKVRDVPKKTIDEERVTVSREDVAPTKVPEIPEKPVPEPLKPKKDAVTP
EKVPEVPKKPVPEPLKPKKEMVTPEKVPEVPKKPVPEPVKPKEEAVIPEEVPEVPKKPVP
EPLKPKKEVPEKVPEVPKKPVPEPLKPKKEVPEKVPEVPKKPVPEPLKPKKEVPEKVPEV
PKKPVPEPLKPKKEVPEKVPEVPKKLVPEPLKPKKEVPEKVPEVPKKPIPEPLKPKIEVP
EK
NT seq 33487 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacaagctccgacatttttacatccgcttcagagcgttgtggcactggagggt
agtgccgcaacctttgaagcgcacattagtggtttgccagttcctgaggtgagctggttc
agagatggccaggttctttccgctgctgctctcccgggcgccgagatttcctttagcgac
ggccgcgctaaactgatcatttctcgtgtgacgccctcacacagtggcagatactctgtg
cgagccaccaatggatcaggacaagcgactagtaccgccgaactgctggtgacagcagag
acagcgcctcccaactttatacagagactacaaagtatgactgcgaaacaaggatccaaa
gttagactggacgttcgtgtgactggaatccctacacctgtggtgaagttctacagggaa
ggagcagaaatccagagttctcccgacttccagattgtacaagatggtgatttatacagt
ttaataattgctgaagtttatgtggaggattctggaaccttctcagttaccgccactaac
agtgtcggacgtgccacctccacagccgaactccgcatccaagctgatgaagtggtacct
gctaaaaagacaaagacaattattacttccactgacatttcccaggcgagacaaatccaa
gttgaaaagaaaatggaagctcactatgaggccagcgcttcagcaactgaaatgattgtt
gatggcaggacagtagtgcagcatttgcatcataagacaccgccacgcatcccgccaaaa
ccaatgagcaggtccccgactccgccaccttctggtgtcaaagtgactcgccaacaatcc
ccatctcctgtccgtcatgtgagggtcccagcaccttcgcctgttagatctgtatctcca
gctggaagactgtcaacatcacctatcagatctgtcaaatctccagttcttactcgtaaa
tctcaaacaactgcagttgttacttcagaagttataccaccttggaagcaacaggactat
gtttcagcaactgaagcacaaaagagagaaagcaaattaattgcaagtagtgcacaggtt
catagagaagaaaaatgggaaaggcgatatggagtccatggacagatgataatcagtgga
gttgatggtgctgctggagctgctagaatgaccgcagttgaacgagctgctggagctggt
gctgttggaataaccacagttgatggaggtgttagtgctgctagaatgaccgcagttgaa
cgagctgctggagctggtgctgttggaataaccacagttgatggaggtgttagtgctgct
agaatgaccgcagttgaacgagctgctggagctggtgctgttggaataaccacagttgat
ggaggtgttagtgctgctagaatgaccgcagttgaacgagctgctggagctggtgctgtt
ggaataaccacagttgatggaggtgttagtgctgctagaatgaccgcagttgaacgagct
gctggagctggtgctgttggaataaccacagttgatggaggtgttagtgctgctagaatg
accgcagttgaacgcgaagccggtgctgctggtgctactaggataactaaagttgagcaa
gtaactggcgcccctagaactaccacagttgaacgagtgactagagttaccacaattgaa
ggagctgctggtgctgctggagttgccgcagttgaaggaagtgctgcagctgttggagtg
agcagtgttgctggcaaagagacagcgcatgacatagaaaaaacagcagctgttgctact
gtagtagctgctgttgaccaagccagagtacgtgaaccagttactgtaagcgctactaca
gaaagaagcacttcagagaaacatgtgtttacagtacaagcacatctggttgaggatcag
attgaaattggcaaaaaggctgaagctgtggctacagtgctggctgctgtggatcaagca
cgtactagacatcctctgtatgctgaaggagtgcattcagaagaggcatcaatggagtat
gaatatgcacagcgtggtgtgtctcaaagtaccactgagttttctgctgaaagacgaaca
gttccagctgaacaacatgttgtcaccacaaccgtcagaaaagggacagttattgtgccg
actgaaacacaaatttcctatggcgagcaagctgaaaaacacatttcacagattgaaaga
gcagcagaatctgccgtacatctggaccacaaagtttccagtacaattcctcacttcact
gtttcaaaaataaccgtagccaaaccagaaacaacccaagaggtttcaatagcaggaact
gctattgttactctggaaaaagagttggctgcgtcttctgctgtgaaggttaccaagcca
gtgaaacctcctgtgttaaaagaggccagagttgtgacagaagagagtgtctctctccag
cctcgatttagagaaagaactgatgtgtatgagacacgatttgatactgagatgcgtaag
catcttggtttaagtatttcaggctcacttgaagctgattttgatgttgaacatgaggaa
gaatatgaagcagaagatgaagaacctgcccctctacccgttccagcagcagttcccctt
actgccccaagttttgtttccggcttgaaaaacatgactgttgttgaaggtgaatctgta
accctgtcatgtgaaatcacaggacaccctgccccaaccgtgatgtggttcagggaagat
tatcacattgaaagttccattgattttcatataacctttgaaaaaggtatcgctagcata
acaattagggaagcctttgcagaggacagcggccgctttacatgtactgccaccaatgat
gctggtactgctagcagttcatgttaccttcttgttcaagtgtcagaagagattgagagc
agagaagagacctttgcagtatcagagcaggctgtccatgaaaggaaaagagttgaaatg
aaagttgaaactctatcaggaacaagtattacacctgagtcagtggaagaaggtgcagga
gtcgctccattctttattaggaaaccaatagtacagaagctcatcgaaggtggaagtgtc
atttttgattgtcagattggaggcacccctaaaccacatgtctactggagaaaagctgga
attccattaacaactggatacaggtacaaagtaagctacaacagagaaatgggagaatgc
aaacttgagatttccatgactttcgcagatgatgcaggcgaatattcagttgttgttcgg
aataaacatggcgaaatttctgcttcaactcagctactggaggaagctgattatgagctt
tacatgaaggaacatgaggagattactgagcgaacagaaatagtaacagagtatgttcaa
gaacccaaagttgcggaagtagcaccaacaattttcatgaccgagtatgaaaaagaacaa
gctctgatcaggaagaaaatgggcaagagtgcagctatgatgaaaaccgtgacagaagaa
caggaataccacatttcttcatttgaagagcgacttatcaaagaaattgaattgcgaatc
atcaggattactttggaagaacttcttgaagaggatggtgaagaaatggtgatagatatt
cctgcagaagaatctatcgcaccaggatttgattcaactttgaaaagtttcagagttctt
gatggcagtggcattactttccattgtaaagtatctggttatccattgcccaaggttgta
tggttcaaagatggtaagcgcttgaaacatgggcagcattaccagatggatatttctcag
gacggcagagctaatctgcgtattgctacagttttgccagaagatgagggcatctacaca
gtgtttgccagcaatgtcaaggggaatgctatttgctctggaaagctgtttattgaaccc
attggtactcccactggccatgcttatttgccaacaacagaaataatgaggagaatgcgt
tccgtgtctcctagatctccaagtcgttcaccagctcgtcgattagaggatacagatgag
actcaactagagagactgtacaaaccagtttttgttctgaaacctacatcatttaaatgt
tctgaggggcagactgctagatttgacctaaaagttgttggtagacccatgcctgagaca
ttatggttccacaatggtcgtcagattgtaaatgattacacacataaaattgtggtaaag
gaagatgggattcaatctttgatcattgttcctgctctgccaattgattcgggtgaatgg
actgtggtggcgcaaaacagagctggcaaaagctctgtatctatgacactatctgtagaa
gctaaagagcatttattgagaccccagtttgtggaaaaactgaaaaatctcagtgttaaa
gagggtgctcccgttgcaatggcagtgaaagctgttggaaacccaaatcctgatattgta
tggctgaaaaatagtgatataattgcccaacacaagtatcctcatattaagattgaaggt
actaaaggagaaggagcacttaaaattgcttctgctgcaaattatgatgctgcctggtat
actgcaactgccatcaataaagcaggtcgtgacacaacaaggtgtaaattaaacgttgaa
cttgaatttgctgaacctgaaccagaaagaaagttgatcattccaaagggaacatataaa
gctaaggagatatcagctccagagctagaaccgctccatttacgttatggccaagaacag
tgggaggaaggtgatttgtatgataaagaaaaacaacagaaaccccacttcaaaaagaaa
actagttctgtgaggcttaaatgttttgggccagcacactttgaatgcagactgacacca
attggtgatccaacaatggttgttgagtggttacttgatagtaagcctcttgctgcagct
aacagactacgcatgatcaatgaatttggatattgcagtctggactttgaagtagcatat
ccccgggatagtggtatcatcacctgtagagctacaaacaagtatggtactgatcagaca
tcagcaactctcattgtaaaagatgaaaagagtcttgttgaagaatctcaattacctgaa
ggcagaagagggatgcagcgaattgaagaacttgaaagactagcccatgaaggtgcactg
acgggtcttgcggaagagctgataaaagagaagacaaagcctgaaatagttttgttccca
gaaccagcaagagtgatggaaggtgaaatagcacgctaccggtgccgtgtcgtaggctat
cctcaaccaaaagtcaactggtatcttaatggacaacttattcgtaagagcaaacggttt
aggctgcggtatgatggtatctattacctggaaattattgactgcaaatcatacgattct
ggtaatatcaaagttacagcagaaaatcctgaaggggtcgtagaacatacggtgaagcta
gaaataaccgaacgagaagattttagatctattttgcggcgagcccctgaacagaaagtt
gacattggccctccagaaccagccaaaccattttttgaagtcattaagatagaaaaacca
gcagatgctgcaaccaaagaagtggtgaaacttaaaaaagctgaaagaattgttcatgaa
aaacaaacagaggagactgaagaactgcgtagcaagtttaagcgtaggcaggaggaaggt
tattatgaagctattacagcagttgaactcaaatcgcgtagaaaggatgaggcttatgaa
gaaatgctgagaaaaagaaaggaagaacttctccattggaccaaagaagtacctgaggag
gagaagaaaccacttcctcctcaaggcaccatcaccattccaacttttaaaccagacaag
attaagttatcaccaagtatggaagcacccaaaattttggagcgtattcagagtcagaca
gtcagccgtggagatgagagtcatttccgtgttagagtggtgggaaagccagaccctgaa
tgccaatggtttaagaatggggtgaaacttgaaaaatctgaccgaatttactggtattgg
cctgaagacaatgtttgcgaactcgtgattcgagatgttgtacctgaagattctgccagt
ataatggtgaaagctatcaatgtggctggagaaatctctagccatgctttcctgcttgta
caagccaagcaagtgattacattttctgaggaaatgcacgatgtcaatgcaaaagagaag
gacaccatggcaacttttgaatgtgaattgtcagaaccatttataaaagtagaatggttt
aagaacaatgtgcagattttctctggtgacaaataccgaatgcattctgaccgaaaagtt
catctcctgtctgtattgacaattggtatgaatgatgctgcagaatacacttgtgctctt
gttgatgatccttctataagatcaacagctaagcttattgttgaaggtgctcttgttgaa
ttcaccaaagagcttgcagatttagaagtaccagaattattctcaggtgaattagaatgt
gccgtttcgaatgaagatgctgagggaaaatggtacaaaggagatgtagagatccaaccc
agcagcaaatactatatttcttctcgtcgtggccggcacactctgacagttaaggatgtt
attaaggaagaccagggcagatacagttttgttgttgaaggcaaaaagaccagctgcaat
ctgaagatgaagccacgtgctgtgacaatccttcaggatcttgaagaccagaccatttgt
gaaggcgatattgcccaacttgaagtaaaattctctcaggaaaacgttgaaggtgtctgg
aagaaggatggccaagaaatcgaggccaacgaacgtgttcacattgttatagacaaaaca
tcacatatgttgctgattgaagatgcaactataaaagatgctggcagatattcattccat
gccactgatttagatcttgtaacttccggacgtttaattgtacaatctattgatattgtg
atccctcttaaagacgttacagttattgagggaacaaaggcagttttagagtgcaaagtc
tcagttgcacatatcacttctgtgaaatggtacttcaatgatcaaccaattcaacttggt
gacaggatacaggccattgcaaaaggagctaaacagcgtttggtaatcagcaagtcattc
gcctcagatgaaggttgctataaacttgtcatcggtaaaactgaaacaagctgcaatcta
tcgattgaacgaattcacattattagaggacttaaagatgggacatgcacagagacacag
agtgttacttttgaagcagagttgtctcatagtggaattgatgtaggctgggtatttagg
aagcaagggctcaaaacaggccccaaatacaagatagaggcaaagggcaaaatttacaga
ttgactgtactgaacataatgaaagatgaagaaggagagtatacatttactgctggtgaa
aagacatcaaaggcaacccttactgtttcaggtggtgctatcagcaaacctcttaaggat
cagacggttccagaatcacagccaactgtctttgaatgtatggtggccaatgcagactct
gagggaatatggtcaaaggatggcaagccaataaccttcggtaatattatccgaagtgaa
gtagatggagttaccaggcgtctcataattgatatcactaaatcagaagatgcagctgaa
tactcataccaagttgcaaactccaagacatcagctaagctgaaggttgaagctgtcaag
ataaagaagactctgaaaaatcagacagtcacagaaacacatgatgcagtctttacctta
gagcttacacatcccgatgtgaccagaagccagtggattaaaaatggggaagaaatcaaa
cctagtgacaagtatgagattaccgtagatggtgtcatacatactctaagaattaagaag
tgtgtaacttcagatgaatctgtgtacaacttcaaacttggcagattgtcagctaatgct
agacttcatgtggaagttatcaaagtaattaagaaaccaaaggacatcacagctatggaa
aatgccactgctacgtttgaactaagtgtatcacatgataatgtgccagtaaaatggatg
ttcaacaatgtggaacttaagacaagtgacaagtgcaaagttattgcacagaggaaagtt
cacaaactagtattggagaatgtcaccccagcacaagttggggagtattcagccattatt
ggacaacttgaatgcaaagcaaaactttatgttgaatctgtgcacatcaccaagactatg
aaaaatgttgaagttcccgagacaaaaaatgcaacctttcaatgtgaagtgtctcatttc
aatgtaccatccacctggttgaagaatggtgtggaaatagaaatgagtgacaagttcaag
gtagttgtgcagggcaaactccaccagctaattataatgaacacaagcaatgaggactct
gcagaatacaccttcatctgtggaaataataaagtgtcagctactctgacagtaaaacca
attttaataacatctatgctaaaggatatgaatgcacaagagaaagatacaattaccttc
gaagtaacagtgaattatgaaggtattacttacaaatggctcaagaatggcaaagaaatc
aaatcaactgagagaacacaaataaagaccaagcaattaacacacacactttcaatccgc
aatattcactttggtgatgcagcagagtacagttttgttgctggatcagcatcatctgca
gcaactttatatgtggaagctcggcatattgaatttcggaagcacatcaaagatatcaaa
gtcactgagaagaagaaagccacctttgagtgtgaagtttcagaaccaaatattgaaata
cagtggatgaaggatggtgcggagctccagccttctgaaagaattaagatgcacagtgag
aaatttattcatcgcctcaccattcctgttacaaaaatggctgatgctggccagtacgca
gcagttgtgggtgaaaatatttccactgctaatttgtacgtggaagcacgacacattgtc
atttcaaaacctgttcatgcagatatccaggtcattgagaaaaagaaagccatatttgaa
tttgaagttgatgaagatgatgttgaagctcaatggctcaaagatggaactgagatcaac
tttcaggttgaagaaagatacagatatataatccaaagacgcgtacatcgcatgaccatc
actgaaaccaaagtttctgattctggcgaatacacctttgtggctggcaggaatcgaagt
tctatgaaacttcttgttaatgttcttgaaccgccttcttttaagttggagttggaacct
tgtgttgtgaaagctggtgaacctgctcgattctgtgctgtaatagttggcacaccaaaa
ttagaagtgtcttggttcaaagatgaccaaaaactttcctcaggatttaaacgcaagtta
cttcatgacgagaaccagtatactttgttactgattgaggcattccctgaagatgcaggc
acctacaaatgtgaagcaagaaatgaagttgggttagctgctagtggtgcttcacttgat
gttgaagttccagaagttgtgtctcctgaggttgaagcacccgtttatccacctaccatc
ataagtccaatacaggacacttctaccactgaaggaaaatctgctcaatttcagtgccgt
gttactgggacagatctgaaggttacatggtatagtaagcagaaggagatcaaacaatca
cggttcttcaagatggttcagtttgaagatacttatcagctggaaattgctgaagtatac
ccggaggatgaaggaatctataaatgtgtggcatccaactctgttggcgaagtgtcatgt
actgcaaacttaaaactggaagattacaaagtgcaaagcatagatagtcagagcataaca
acttctggaaaagctgtagacgaatccatcgtttcaaagacttttgaagtatcaaaaatg
catgtggagtcccctgtgaccataacgcatacaaagaactatgcaaaagaaatcagttta
cagcaagaacatacatacaatgttcagatgtttgaaagtgtttccatgaattcatcgagc
aagaccgtttcttctgaaagatgggaagaatgccaaaaaattgcccacacagaaacaatc
agaagtggctaccaatgtccaccaaaaatcctgcaagatatgaataatgtcccagttttg
ttaggtgaaacggcatctctaaaatgtcaagtcttagcattcccaagacctgaaataaaa
tggtacagagaaggccaagaacttgtggcagttaagagaataaaaattgtcactataaca
gaggatgaagtcttgacgtcatcagaattaattatacgagaagttcaagaaaaagacaca
gggacctatagatgtaaagctctaaatctttatggtgaggttaaatgtgaagctgaaata
actgttactgcagctaaacctgcccttgaggttcccatgattctgcttgaacttagtgat
ctgagggtgaaagctggtcaggtggcacaattcatctgttcttttagtgggcaatctttc
tcagaggtcatttggagtcaaagaagcaaaagactggaagaatcagaaagactgaagatt
tctcagaacggaaatgtcatgtcactcacaatccttaatgtgcatttagaagatcaggga
cagtacagctgtactgcaagaaatgaaggtggtgaaatgaagactacagctgtactaata
gttgaagctgaagaatcaaaacccaaaacaggtgcaaaaattcccactgatagcaattca
gatagcactaaaactgaacaaagaccacatattacatctgatagcaaactagaagtacta
acgaagccatcaagtccaccaccatcttcaaccaaaaggccaattcgaagagagaagcca
aggagccatgattattatcctgacatagtgcccttcgatgagctgatagacactggagcc
atagcaccgatgttcttagaaaagttgccaccagaagtcattgtacaaaacggagaagat
gttttactgttttgccttgtaaaaggtgtaccatcaccctgtgtactttggctgtacaac
caacgcatagttgaagaatcttcattgtgttccattaaacatgatgggttgctatgcagt
ttaaagttacagaaagtcagccggagtcacagtggcacttattcatgcaaagcggttaac
tctgctggagaaacagcgtgcaacacactacttagagtgacagctccgaagattcaagac
aaaattgaacagcaaatagaaatggaagtgagagaattttctagctctgttaccattgct
gctgaagatgagagggaagatttctacagcagtgaacttcatgtgtcagacaaaacattt
gaactcaagcctgaaactgcaaccctttctagcactttggaaataaccacagatgctaag
cctctgcaaacagtgccagtattcattaagcrcatttctagtatagaggtagttgtggaa
gatgtagctaaattctctgtcactgttactggattcccaaagccctctattcagtggttt
tgtaacagtaaaaaattgactccttcatcaaactacaagtttgtttatgatagggatgaa
tatagcctgatcataccttatgcaaaatttacagatgagggagaatatagctgctctgct
actaatatacttggagagacttcatgtagtgcatacctgaagatcaaaccaaaggaaggg
tttaggaaatcgtctgcaaagcccccacttgcaaaattagcagatagaaaaatgccagtg
atgccaacagaaatcatacatccacctaggggtcagccaccacattttttccaggaactg
aagtctttacagtgcccagaaggcctgcctgctatatttgagtatgtagtgataggtgaa
ccaataccagaagttttttggtacaaggaaaacaaccaaattcatcagagtttgcattgc
agccttagttctaactctgatggctctggttcattaactattaataaagcacagaaagag
gacagtggcttgtattcctgcaaagcatttaatcagtttggggaaacaacttgcactgca
gagctaactgtgttcagtggtacgtttgctaccactgaacatacaaaagaggaagttgct
cataagcaccatactcagacatataaaaagtctgtaagtgaccatgccacagagtcacgt
ctgttcatggtaacattgcctggtgatgctcaggctgagttacaagacagagatcaactg
gtctatacgatagcttctgaagataaacattctgttcacagtgaacagacaggcatgttg
catgaggtaacagtctctgctgctgaagcaacaattgcagggaagagtcagatagtaatg
cattcacaaactactcaagagagtctaggatatatagagcaacattatgaacctattaaa
agtccaccaatacttgaattgtcaagcactgaagtacggttagacactgcccttcgtttg
cccacagttgaggagcaaacagtcattccaaaggaaagtagctttagtatcagagattca
cctactataacggctaaaacaaaaagaaaagaagtaagcatcttatctgaggaaaagcgt
ctaattcctagctccaggacttcaactcttgacattgtagaacaagaaatatcaaaaaca
gagcctgcatatcctttacacaggtacaagattgagggacatcaagaacctcccaaagaa
gctttgtttgcctttgaaattcccgacggacagaaatgtgaaatacaaagagaaagaaaa
atggaggttcatacagccgtagcaacagagaacaaaagagtaagacatgaaatgaccaaa
gacatacaaacgttagatgcagcaagaaaggcaaagttgtcaaaggaattgccaaaacca
ttcttgacgtctgttactgaaagccagaaatcactaccaaaggaatctctgtttgaagtg
caaaaaggtgacatacagcaagcttccttgatgaaagataagtttgttaaaactgcttta
actacagaagaaaagcagcagctcatgggtgaacatgctgatataataattggtttagat
agtgcaatctcaataacgtcaaaaaaagaagtaaagaaacctttgcatttacaaattgta
cagggacaggacactctgcccaaagaaacaacttttacttttgaagtacctacagaagag
aaagctgacaccagaagaagcccaacgttgctacattccttactatcagaagagcagcat
cttatacctgaagaacatacaactccattatctgatgcaaaagataccacaataattaaa
cctacaaaagaacatatgcctattttttgtcctcattctgtgatgactgcttgcattctt
cacaaggaagatcttctaccttatgagaaaccagctactcatatggcaggacacagactt
gagaaagcatatagctatgctgctgttatagaagagaaaccagaattgctagctgaacaa
actaaaatgcttgaaatggaaattaaaagttcaaaggctgaagccaaaactgagcttctg
ccacgagagtttcttccatctgtaactgtaccaatgcacatagcaaaggagaaaatgctt
accattgagggtaaagaacagcgtgcaatcataaataagttggatgacacagtcaaacag
ttcagtactataaccgagaacaaggtagtggaagatggttctgttgccatgtttgaaggc
ttagatgcagcaagctgtgaagacaaatatgaatcaaaactcccttcaatttctgttcag
gttaaagaaaaggctgtagctattgaaagcaccacaatgttagaagctgcagaaaaggat
tttgcagcaagaatccaacagggacagtcagtaaggtttccattgttgcttcaagaaaaa
cacctcattgaagaagaacattcttcagcaatcacaagatcggaaaagaaagttctaaag
gtagaaagacaacmaaaagagaaacttctcactcatgtaatacaagaaagtgaggtactc
caaaaagaaaaagcacttaatattgaagttccccaagcatccaccttagatgttggtgta
cagattagaaaagcattgcaatctgctttggcaagtgagcaatgtgttctttcatctatc
tcattgggtggcgtagaagaggtggagattaaggaattaaaagttcaaaaagaacccgcg
tgtattttatatacatatcaaattactaatgtcaatcctcctatagacataactctgtca
tttgaaggagaatatcctcagaaagctgacttaagaaaagaattgacggctgctttccat
gctattactcatgaacaacagcgtgcttttctggctgaacaactggatacaatccgtcca
ccaactgatgtgttagaaaaattacacatcagcattactcctgctaaagagattttctca
cctgaggctgtcaccatttctgaaagcacctttgaggccgggatgcatgtggctgaacag
aaactccagacaaatattacagtttcccaagattattctgtaatctcaaagaaggcagct
gttcaagaaatgacaacaaccactgaatcagagggttttactcaggattttaaatctgtg
gaaactgttgaagaagtgacaatagtgagtcacaagagagatgttggtggtacaataatt
actacagatgcccctccagcacctgttccaatggaacagtcaacagaaattctcaaaaaa
gagaaggaaatggaagaaattatagttactcatatttctaaaccaagaaagctaggtgaa
acaccaataaagccccccaaagacaaaccagtaattgttaaaggacttacagacatcact
gttgatgaagatagtgaagtaaagttgagcacagtcataactaaagttaacaaggtaaat
tggtatatcaatgggaaacgaatcacttcaaaaaatgagttcaaatgtttgcaagaacgt
gacacttactcacttataatcaacaaagtacagaaagaggagcatcaaggagaatatgtc
tgtgaggcactgaatgaagctggaaaagcaactacttctgcaaaactcacagttattata
agagtgcccccatctttcaagaggaagattgaatcactggaggtgatagttggacagcct
actcagtttgaatgtgaagttgaccccattcctgatgtaaggttccaatggttccgagca
agagctgaacttcgtgacagtgaaaagtacagcattgtgaccgagaaatatacctccatc
ttgaaactcttgaaaccccagctaattgactgcggtgactacacgtgtagagcatcaaac
cggtgtggcagtgtaagcagcacagctaaactgattgtgactgaacttaccccaccaagc
ttcataacgagactgcaatcagttacaacttttgtgggtaagacagcaaaacttcagtgc
gcagtggcaggatcacccgtgatccataccacttggcagaagaatggtgttgatattact
gatgaagagaactacaaaatatcagtcaaggacaacaaacgtattttagaaattcgtgac
ctaaaggttcagaacaaaggaacctattcttgcaaagtgaccaatgactgtggtactgat
atttgcagtgctgatctaacaatacttgacaaaccacatttcactaagactcttgaacct
actcagacaatacttaactgcggtacgcatcttgaatgtcaagtagatgaagacacagca
gttaaaatttcatggaaaaaagatggtatagaacttcatgctggcaaagattacaaaatt
acatttgaagacaagacagcagttttagaaatcctgaaaaccaaactgaaggatgcagga
aattatgtatgtacagcttcaaatgaagctggaagcaattcctgttcagcagcattaaca
gtaaaagagccaccatcgttccttaagaagctagaaccaacattgctgttgaaacaaggt
gattcagcacacttgaagtgccaagtgaaagggtcacctgaaatcaatgttacctggtac
aagaacaataaggttctccattcttcagaaaaattcaagatatcatttgttgattctaca
actgttcttgaaattaataatctaaatgtagaagatagcggagattatgtgtgtgaagca
caaaatgaagctggtactgatacttgcagctctgtcgtcacaatcaaagagcctccctct
tttagcaaagcatttgaacctactgaagtggtaaaaggatttggttgcactcttgaatgt
gagctgtctggcacagctccatttgaagtcctctggcataaagacagaaaaccaattcgc
accagcaggaagtacaagatggtttcccaagatgctcatgtttcactccatgttagcttc
tttgagtcctcagatgttggtgattatcaatgcactgtttcaaatgaattagggaaatgt
gtctgtggtgcaacagtaaagttgaaagaaccaccatcatttgtgaagaagattgaaaat
actactgcacttctaggaagctcagctatatttcagtgcagcatcaaaggctcacctccc
atcactttaacttggctgaaagataaagatgttgtcacagagagtaataatgtcaaaatg
acttatgagaataatatcagtactcttcaaattgctgctgttgaaatgaacaatggtgga
aagtacgcctgtattgcggaaaatgaagcaggaagtcaaaaatgtttggcaacattagtt
gtaaaagagcctgcaaatatcctagagaaagcagagccaattagtgtgactgcaggggac
ccagcaactttggaattcacagtagctggtacaccggaactaaaaattaaatggttcagg
aatggcaaagaactgatatccagtagaaaatataaaatgaccttttcaaaaaacgtcgcc
agtctaaggattatttctgcagaaagtgaggatagtggtgaatactcctttgaggtcaaa
aatgatgtgggcagttgcagttgcaaaacatttattaatgtactggatcgtatgattgca
ccctccttcactaaaaagttacgaaagatgaccagcatcttgggtgctacttttcacatg
gaatgcaaattttctggttctatgccagtcagcgtttattggtataaagatgacaaagag
ttaacagccagtgataaatacagaatactttgtcaagacaacacagctactttgacagtt
gatcagttagagattgcagatggtggaacttactactgcaaagttactaatccagcagga
agtgatgaatgcagtggagtcttaagtataaaagagcctccaagctttattatgaagcct
gcatctgagcatgttctgccaggttcaactgtgaaatttaagactgtggtgaatggtacg
cctccaatgtcaatgaagtggttcaaggataacacagaacttgtgactggtggcacctgt
tttattatgaaggatatttctacaacttatcttgagatattttcagctaaaccttctgac
aagggcgattacatttgtgaaattagtaatgatgctggagtcatttcctgcagcacaaac
ctttttgtaaaagaaccaccagtgtttttacggaaaccagagccatcaaaattactgaaa
aagagggaagacaagcaaattcacccgagtgagaagtatagaatatcatttgttgactct
gtggccattcttgaaattcttgaaggtgatgtggaagacagtggagaatacagttgtgaa
gctaagaatgaagttgctagtgagcgttgcagtgtttctgtaacaattaaagaaccacca
tctttcagaaaagaacttgaatctcttaaggtgctcaaaacctctgatattattcttgag
tgtgaagtggctgaacctgcaaatattattgagaaagcagaatctattagtgtaactgta
ggagagccagcaacattggactgcagttttacaggaacaccagaaattaaagcaagatgg
tttaaggatggcacggagctggtgactggtagaaaatataaaatcagtgttactaataaa
gtgacaagtttaaagatccggactactgagaaggaggatagcggtgaatatacttgtgag
gttgcgaatgatgttggaagcagcagttgcaaagcttctgttacaatattggatcgcata
gttccaccatcattcaaaagaaacttgaaaaatatggatggcatgaaaacatcttttgtt
aagatggaatgcaagattgctggctctcttccaatgagtgtgttatggtataaggataac
caagagataatcgctaacgaaaaatacaaattctcttatcatgataacaccgcacagttg
gagattcatcagttagagatggcagatggtggaacttacgtttgcagagcaataaatgcg
gcaggaactgatcaaagtagtggtgtcttgacagtgaaagagcctgcacagttcattaag
aaaccagagcggaccatgtcattacaaaaaggaggttcagtacgtcttgagtgtacagta
actggcacgcctgaaatcaaagttacctggtataagaaagaaagtgtcattcacccaagc
gacaaaatcaggatgtcatttgttgactcagtgtcattctttgaattgattgatgccagt
gtggaagacagtggacattacacttgcagagcagagaatgaagctggttttgatatttgc
aatgtcatagttgcaattaaagagcctccttcagttagaaagaaactcgaacctgttgag
gtagtaaaaggcaatgatatcaatcttgaatgtgaagtggatggtactggcccacttgac
gtcacttggtataaagataataagcagattcgagcaagtataaagttcaagatgttcatt
ggaaaatctttatttagtctttctgttcaaaaagctgataactcagacgttggtgaatac
aagtgtgaagtaacaaatgatgtgggaagttgttcttgtgttactggagttagattaaaa
gaacctccttcctttgtgaaaaagattgaaaacattacaatattatcgcaaagtgcagcc
agttttaccagccaaatacaaggatcgtctccaatacttgttacatggatgaaggacaaa
gatgaaatcagagaagatgaccatattaaaatatcttttgagaacaatattgctacactg
caaattgcttctgttggagcaagtgacagtgggaagtacacatgccaggccataaatgat
gcaggaacagagaaatgttttgctactttgtcagtaacagaacctgcacaaatcatagag
aagccacagtcattaagtgtcacttcaggagctgcagccatcttagaatgtgttgttgct
ggtactccagaactgaaagtaagatggctcaagaatgaaactgaattgacatccagcagg
aagtataaaatgacttttgtgaacaaggcggcaatcctaagggttctgtctgttactaaa
gaggacagtggcgaatatgtttttgaagttcaaaatgaatttggacaaagcagctgcaaa
actacgttgacagtactagatcgtataattgctccatcattttcaagaagtttaaagaaa
atggatggcatcttggggacattgatgcacatggagtgcaaagtatctggttccctacca
atcgacattgtttggtataaagataacaaagagatatttactggccccaaatacaaaata
tcatttgaagaaaatacagcacttttggagatcaaagaacttgaactcacagatggtgga
aattattcgtgcaaagcaacaaatactgcgggagtcagcgaatgcagtggattcttaaca
gtaaaagagccaccaagctttgtccaagaaccagtatcccaagcaattgtacttggtgct
acaatgcagtttaagagtgttgtgaaaggaactcttccactgattgtcaagtggttcaaa
gataacagggaactgaggcctagtccaagatgctccatttggaatgaagaaacaacacac
tactttgagctaaactcagcgaaaatttccgatgctggtgtttacagctgccatctcagc
aataaagctggatcagtcacaagcactgcagaagttttcatcaaagaacctccaagtttt
gttaagaagccagctccttcagcagccctgaagcaaggagaatttgcacgttttgagtgc
aaaataactggtacacctgaaatcacagttacgtggtacaaaaataacacagagattaga
accagtgacaaatacaggacatcgtttcaaaacacagtggctgtgcttgagattactgat
gcaagtgtggaagacagtggggaatattcctgtgaagcacagaatgaagttggtggtaat
agctgcaactttttggttcaagttaaagaacctcccacatttataaagaaacttgaacct
gttgacgtagttaaaagtgatgatgtaactcttgaatgtgaggtgactggtacagctccc
tttgaagttacatggtataaggataataagccaattcgacgtggcaaaaaatgcaaaata
atctttgaaaattctttagccagtcttaccattctaaagtctgatactcctgatgttggt
gaatatacatgtacaataaaaaatgatgttggcagttgctcctgcagttctacagtcagt
ctgaaagaacccccaggatttgtaaagaagattgaaagtgtaacaacgttgtcagggaat
tctgttgtgttccaatgtgtagtcaaaggctcaaagcctatttatgtaacttggatgaaa
gacaaagatgatgtcaaagaagatggtaatatctcactgccttttgagaataatattgct
actcttcaaataagtactgttggagaaaatcatgctgggaaatatacatgtcatatcaag
aatgaggcaggaactgagaagtgttctgctacgttgttggtagcagaaccagcaaaaatc
atagaacaagcacagtcactcagtgtgactgcaggaaatccagcaaacctggaatgtacc
gtagctggtacaccagagctaaaagttaaatgtttgaaggatggtaatgaaatggtacca
agcaggaaatacaaactcagctttgaaaataatgtgatcagcctaaagattccttctgtt
tctaatgatgatactgctgagtatacttttgaggtcaagaatgaatttggaaccagcatc
tgcaaagcttcattgactgtattagagccaccaagttttgtggaaaagcctgtagctcag
gaagctctgcctggatccacagtacagtttagaagtgttgtgaaaggaaccgctccactg
tctataaaatggctgaaggatggcagggagctgatgtctggagctgactgttccatttta
agtgaaggttcaacaagtttacttgagttgttttcagctaaagtctctgatttgggtgac
tatacttgtgaagtcagcaacaaggttggcactgctacttgtacagcaagactatttgtc
aaagaacctccatattttgttaagaagttagatcctgcagcaatatttaaaaagggagag
acagcaaattttgagtgcaaagtaactggaacacctgaaatcaaaatctcttggttcaag
aattatcaggagattagtgctaatcagaaatacagaatgtcatttgttgattctgtggca
aaccttgaaattgctaatataagcctcgaagacgatgggatttattcttgtaaagcacaa
aacgaagctggcagcaaatcatgcgagatgaaggttacagttaaagaacctcctacattt
acgaagaagcttgaaccagttgaggtagtaaaatctactgatgtcactcttgaatgtgaa
gtggccggttcaagtccctttgaagttatgtggtataaagacaataaacaaattcgacgc
agtaaaaagtacaaaataatctccgatatttctttagccagtctttgcattctaacatcc
gatagctcagacattggtgaatacacatgtacagtaaaaaatgatgtcgggagttgctcc
tgcagttcgacagtcagtttgaaagaacccccaggatttttaaagaagattgaaaatatg
accacagtgtcagggaattctgttgtgttccaatgtctggtcaaaggctcaaagcccatt
tatgtaacatggatgaaagacaaagattatatcaaagaagatggtaatatctcactgtca
tttgagaataatattgccactcttcaaataaatactgttggagaaaatcatgctgggaaa
tatacatgtcatatcaaaaatgatgcaggaactgagaagtgttttgccacattgctggta
gcagaaccagcaaaaatcatagaacaagcacagccactcagtgtgactgcaggaaatcca
gcaaacctggaatgtaccgtagctggtacaccagagctaaaagttaaatgtttgaaggat
ggtaatgaaatggtaccaagcaagagacacaaactcagctttgagaataatgtgatcagc
ctaaagattccttctgtttctaatgatgatactgctgagtatacttttgaggtcaagaat
gaatttggaaccagcatctgcaaagcttcattgactgtattagatcaaattataccccca
gtgtttacaagaaaattacgggaattggatgctattttgggatctttcgtccatatggaa
tgtaaagcttctggttctcttccaatgagttttacatggtataaagatttcacagtaata
acatctgatgagaaacacaaaatattaagccaagacaatgcaacaatgctggaagttaat
gaactagagttttctgatcatggaacctacatttgtaaagcaaccaattcagcaggaagt
gatgaatgcagtggtatcttaaaagtaacagagccaccaagttttgtggaaaagcctgta
gctcaggaagctctgcctggatccacagtacagtttagaagtgttgtgaaaggaactgct
ccactgtctataaaatggctaaaggatggcagggaactgatgtctggagctgactgtttc
attttaaatgaaggttcaacaagtttacttgagctactctcagctaaagtctctgatttg
ggtgactatacttgtgaagtcagcaacaaggttggcactgctacttgtacagcaagacta
tttgtcaaagaacctccatattttattgagaagttagagcctgcagcaatttttaagaaa
ggagagacagcagtttttgagtgcaaagtaactggtacacctgaaataaaagtctcttgg
ttcagggattatcaggagattagtgccagtgaaaaatgcagaatgtcattcgttgattct
gtggcaatcttggcaattgttgatataaacctggatgacagtgggaattactcttgcaaa
gcacaaaatgaagctggcagtgaatcttgcgagattaaagttacagttaaagaacctccc
acatttacgaagaagcttgaaccagttgaggtagtaaaatctaccgatgtcactcttgaa
tgtgaggtggccggttcaggtccctttgaagttatctggtataaagacaataaacaaatt
cgacacagtaaaaagtacaaaataatcactgacatttctttagccagtctttgcattcta
aaatctgatagttctgatgttggtgaatacaagtgcacagtaaaaaatgatgttgggagt
tgctcctgcagttctacagtcagtttcaaagaacctgcaaatgtcaaagataaagctgag
ccactcacagtgactgcaggaaacccagcaattttggagtgtactgtagccggtacacca
gaattaagtgttgcatggttcaaaaatggaaagcaactggaatcagttggaaaatataaa
atgagttttgcaaataaagtggcaagtctaaaaattcagtccgttgaaatggatgacagt
gctgactatactttcaaagtccagaatgaatttggagccgacagctgcagtatttctttg
acagtgttagaacaaataattgctccattgtttacaagaaaattaaaggaaaccagcagt
actttaggatcttttgtacaaatggagtgcaaaattgctggttctattccgatggacatc
tcttggtataaagatggcaatgaaatatcagccagtaacaaatacaagatggtatttcaa
gacaacatgctgtctttggaggtctttgagttagacgtttcagatggtggaagatactct
tgtagagcagcaaattcggcaggaaaagatgaatgtagtgctttcctaagtgtaaaagag
cctccaagctttgtcgataaaataacatcacgggatgttgtacttggttctactgtacag
tttaggagtgtagtgaaaggaaccacaccattatctacaaaatggctcaaaggggacagg
gaattgatgcatggtgtggcatattccatttggagtgaaggctcaacatattttctagag
ttggtctcagctaaaatatctgatgcgggtagttacacctgccaagtgagcaacgatgtt
gaacctcctagcttcattaaaaagttaaatccgtccacaataataaagaaaggagacgca
gcacgttttgagtgcattataactggcacaccaaaaatgaaagttacttggtacaaaggt
ggtcatgaacttctagccagtgacaaatgtgtgatgtcttttgatggttctgtggcagtt
cttgagattattaatgttagtttggatgacagtacatgctacatctgtgaagcaaggaat
gaagctggtagtgacagcagcagcaccgaggttgaagttaaagaacctcccagttttagg
cggaaacttcaatctgctgaggtaataagaaacagtggtgtcacccttgaatgtgaggtg
gctggtacagctccctttaaagttatgtggtacaaagacaataaacagattcgatctagt
gaaaaatataagatggtcactgagaactattcaattagtcttcatatgttgaagattggt
ccttcatttgtcggtgaatataaatgcagagttactaatgacgtgggaagctgctcctgc
agttgtggtgtcagcttgaaagagcccccttcatttataaagaagattgaaaatattata
gtggttgctggaaatcctgctacatttcaatgtcatgtgaaaggttcacatcctttatct
ataacttggatgaaaaataatgatgacatcaaagaagatgataatctagcaatttccttt
gaaaacaatattgctaccctgcaaattaaagctggtgactcaaaatatagtgggaaatat
atgtgtcaggctaaaaatgatgcaggaattgagaaatgttttgctacattgatagtaaca
gaacctgcaaaaattgttgagcgagcaaagtcacacagtgtgactgcgaaaaatccagca
aatttggaatgtactgtagctggtacaccagatctaaaagttaaatggttgaaagacgga
aaggaggttacatccagcagaaattgcaaattgagctttgagaaaaatgtagccagtata
acgattctgtcagtagagaagtcaagtagtggtgaatatacttttgaagtccagaatgaa
tatggagtcgacagctgcaaagctttcttgactgtattagatcaacaaattgctccaaca
tttacgaaaaagttaaaggatatgggcattgcattagggtcttccatgtacatggagtgc
aaagtatctggctcttttccaataagcattcattggtacaaagatggaaacgaaatatca
gatagcaacaagtataaaatatcacagcaagataactcctcaactttggagatgaatcaa
ctagaaatcgcagatggtggaatttatacttgcagagtaacaaatgtagcaggaagtgat
aagtgcagtgccacacttgttgtgaaagagccaccaagatttataataaaaccaaagtca
caggaggttccccccaattctgcagtgcagttcaagagtgatgtgaaaggaacacctccc
ctgtctttcaaatggtttaaggatgacaaggagttaaactctgatgctacgtgttgcata
atggcagaaggttcatccagttctctacaactgtattcagtaaaacattccagtacagga
tactatacttgccacgtcaccaatgatgttggcacaaatacttgcacagcaaagttattc
gttacagagcccccatctttcattcagaagctggagccatccaaagtactgaagaaaggt
gaatcggcacactttgagtgcaaagtgacaggcacacctgaaatcaaggtttcatggttc
aagaatgaccatgaaattagtgctgataacaaatacaaaatgcgtttcgataaatctgtt
gcagttcttgagatcattcatgctgatctggaagatagcggtgattacatttgtgaagct
caaaatgaagctggcagtgcaagttgcaatgttgcttttactgtcaaagagcctccagtt
ttckttaaaacacttgagacaattaatgccataaaaggctctgatgtcgtacagcagtgt
gaaatcagcggtacatctccttttgaaatcacctggtataaagacaaaaggcaaatccga
gcaagtaaaaagtacaaaattacttatgaaaaccatgtagcaagtattcatattctgaaa
gttgagacaccagatataggcgaatacatgtgtgtcgtcaagaacgatgtgggaggtgac
acttgcattggcacattaaatctaaaagagccgccagtatttgtgaagaaactttcaaac
atttcttctgtccttggagagtctataactttacaagctaccattaaaggctcagaacca
attcatgtaacatggatcaaggaaaaggaagaagtgaaagttgatgagtatatgacaact
agctacgaacaaaatactgttactttgcatattgcaaaaatggaagcagttcatgctgga
aagtatgtttgtcaaattaaaaatgatgctggaatgcaagaatgcattgctacagtatca
cttctggaacctgccacaattgtggaaaaagcggaatctgtcagtgtaaatgcaggagat
ccagcaactttggaatgcattgttagaggctctccagaactcagagtgaaatggctgaaa
gatggtcatgagctagcatctggcagaaagtatcagatcagttttataaatggaatttcc
aacctaaagattctgtctgcagaaaaggccgacagtggtcaatatacttttgaagtgcag
aataatgttggtagtagcagctgcaaarcatcagtsagcgtcctagatcgaattattcct
ccgaaatttacaagaaaattaaagaaagtgaatggtatcctggcctctcccatccagatg
gagtgcaaagtgtctggatcacctcctattgctttggcttggttcaaagacagacaggag
attgtacatggagcaaaatatcaactcacatttggagataatacatgtggtttgaaaata
agtactttggaactgtcagatgctggtaattatacatgtaaagcaacaaatgctgcagga
agcgatgaatgcagtggtgtcttgactgtgaaagaaccaccttcatttattagcaaacct
gattctcaggaagtttcacctggttcaaatgtgaaatttacaagcattgttactggaaca
gatccattaaaagtatcatggtttaaaggtactactgaactggtagcaggaaggcaatgt
catatttctttaagagactcaacagcagtattagaactactaaatgtggaatcttcccaa
agtggagactatatctgccaagtcagtaatgaagctggcaaagtttcttgtacaacaaaa
ttgtttgtgaaagaaccagcagtattccagaagaagttgaaagattccagtgttgtactg
gggaagtcagtttgtctagactgcacgtacactggtaccccagaaatcaaagtcacctgg
aagaaaaatggattagctatattccagtcagacaaacatattttaactactactgaaaca
tcttgtattttggagattctcaactgtactagagatgatgatgcaaaatactcttgtgag
gtagaaaatgatgctgggatggacacttgtcatgctgaagtgaaagtattagaaccacca
acgtttgtccaacatttagagcctctggaaataacattaggagatccaggatttttcgaa
tgcagacttgctggaacacctgaaattaaagtgtcttggtacaaaggagacacgaaactg
agagccacccctaattgtaaaatagagtttgtgaacaatattgcaagactggaattgaag
aaaacaactttgagtgacagtggagaatttatatgcaaagctgaaaataaaatagggacc
tgctcatcaaaggccatgctcaccatccaagaacgtaaaattgcaccttctttcacaagg
aaaatgcagggaatggaaggaactctccatcttccagtgacatttgaatgtcatatttct
ggttcaacacctattgaaactacttggtttaaagatggtgtaaaactaactagtgatgaa
aatgtacttatatccttcatagggaatgtagcaactcttaaaattcttaaagctgagatg
catcatgctggtgaatacacttgcaaagctaccaacatggttggagatgcttcttgcagt
tcaagactaactctgaaagaggcgagggttgcccctgtgtttgacaaaaaattagagccc
atcaaagttatcactgggcaaagtgtagaacttgagtgccatgtaactggctcttctcca
attaaagttatttggctgaaggatggcaaagagattcgttcaaatatgaattataagata
tcttttgtggaaaatacacctcacttgacaattctaaaagcagacaaaggagactcttgt
cagtacatttgtgaggctagcaatgatcttggaagggactcaacgcaaacacaagtgact
gtaaaagatcgtaaaattccaccaagctttactaaaagacctcttgaacaaatacaggat
gcagaaggaaaagctataaaacttgaaggtcgagtatctggttcacaaccaatatctgta
acctggttcaaagatgatcaagagatcctacaaactgaaaattatgaattgtcttttaaa
aataatgtagtaacactgaacattaagaaagcacatctcactgattctgctgtttataca
tgtaaagcatccaatgaagcaggaactgcaatatttactgtgtcggtactgatcacagag
tttatagcgcctcctgtctgggacatacctcttaaaccaatgacaataaccgaaggagaa
tctttgcagtttagctgccatgtccatggatctaagccaattaagatacagtggtttaaa
gacagaaaagaaatgaagccatctgaaagattgaatttcaccttcaaggatggtacagct
gccctagaatgtaaaacatgcactaaaacagatagcggtgactacctatgtaaagctaca
aatgaagctggaagtgttttttgcaaagccaaactaacagtccaagaaaaagctgtagca
aagaaagtggtttctccaccaaagacagacaagatcttcttcattgagaaaccaaagagt
gtgaaaataacagaaaagagtattgcaacgttcactgcaaaggtaggtggtgacccaatc
ccgaatgttaaatggatgaaaggaaaatggaggcaaataaaccatggtggccgaattatt
gtgcagcaaaaaggacaagaggccaaattggaaatcaaagatacagtaaaaactgactct
ggacagtacagatgtgtggcatctaacaaatttggtgaaattgaaagtagtgttaatttg
gaaattgaggagaagaaagaaattattgttgaaaccgacttcagagctaaactgaagaaa
acaccttccaaacaaaaagaagaagaggcagacaaggatattgacattgtggaactgctr
aggaatgttgatcctaaagaatatgaaaagtatgcccgcatgtatggaattactgatttc
cgtggtctacttcaagccattgaacaactgaaagccagcaaattggaagaacgtgaacga
ggtcctgaagaagaggaatttaatgaactgatccagtatatccagcaaagaatagaaaaa
gttgagcctattgaattaaccaaggacattgaagaccaacttgtacgtacaaatgcggat
gctgtgtttgaatgtgtgataaagataaactatcctgaaatcaaactttcttggtacaaa
ggaactgaaaaattagaatcaaatgacaagtatgaaattagcattgatggtgacattcac
tgcttaaagatcaaaaattgcacactgcaagatcaaggcaacttccgcattgtctgtggc
ccacatatttccagtgctaagctgactgttgtcgagcccatagttgaacagcaccttgaa
aatctttctggtaaggaaggccatatttgcatcatggtttgccagttttccttacccaac
ctgaaaactgagtggtttaggaatggtcgaaggattgagggacaaggcagatattccrta
gacgttgcagataaattgcagaaggtcactattagtgacttgagaccagaggatcaaggc
cgatttacttgcaaatatgaagatcttgaaacatccgctgatctacttgttgaagcgcaa
ccaattgaattcacaaagacaatccaggatatcgtggtgaaagagcatgagtctgctgta
tttgaatgtgaagtgtcctttgatgatgccattgtaacctggtttaaggatacagtggtg
ctgaaagaaagtccaaaatacagcttcagaagtgatgggcgacgacactttatgactatc
cataatgtcacaacagaagatgaaggggtttattcagttattgctcaacttgagccaaga
ggtgaggctaaaagtactgcagaactttatgtttcaagccaagaaatcaccttgaagccc
aggaaacctggaaaagaatgggcagaagaaatagttgcagaaaaatatgagatcagtgaa
gatatttcatacacaatattggaggaagaggaacacggccgttggaaagtctacaataac
aataatgtctttgaagtgtctggagttggcaaaatatccattcctgagaaagtacctgaa
ccagctgctccccctcgtctttccattgaacaggaaccagttccacgaaaagagcctaca
aagcgtataattgaggaagttgaacaagttacagtttcaagaaaggaagtagttcctcca
aaaaaagtgcccraagttcctgagcctcttcctgaagaaaagaaaccaattatacgaaaa
gagaaggttcctccaacgaaagatgttgctgagaagcctactcctgaagaaccagtgccg
gttcaaagaaaagagaaaatcacaacagtaaaagtgacagagattactaagaagccaact
gttgaagaagtaaaaccaactattgtgccaagaaaggaaaaggttgctcctgcaaaagtg
ccagaagtccctaagaagccaattcatgaggaaattattactgtgcgaagagaagacatt
attccaactgaagttctggagatctctgagaagacattcgttgaagaagtgaaagtgatt
acgaccacaacgaaagaagagatctttccacctccagtgccagaattcattcagaagacc
cttcctgaagaagttaaactagtttctgttccaacaaaagatattataccacctaaagtg
ccagagatttgtgagaaaccagctgtggaagaagtaaaaccagccattattccagaaaaa
gcagagattactccggctaaagtgccaaaggttcctaagaagcctctggctgaagaaatg
aaaccagctcgtcttccaggaaaagaaccagtcacaccagtcaaagtgccagaagttcct
aagaaggcccctgttgaagaaattaagctaattactcctccaagaaaagaggaagcccct
ccagctaaagtgccagaggttcctaagaagccaataaaaccagaagaaaaaccaaccatt
gttccaagagataaagtagcaccaactaaagtcttggagattcccaagaagccagctgac
attgaagctcagccagttactatattgagaaaagaagaagtcatcacagtgacagtgcca
gaagttcctaagcaggcagttgctgaagaatttaaaccagctgctgttcctaggaaagaa
gatgccattacagtggaagtgttggaggtgccaaagaaaccagttgctaaacaagtccaa
ccaattgaaatttcaagagaaaaagtcactcctataaaagtgcgagatgtcccaaagaaa
acaattgacgaagaacgtgttactgtttcaagggaagatgttgcaccaaccaaagtacca
gagattcctgagaagccagttcctgaaccattgaaaccaaagaaagatgcagttactcca
gaaaaagtgccagaagttcctaagaagccagttcctgaaccattgaaaccaaagaaggag
atggttactcctgagaaagtgccagaagttccgaagaagccagttcctgaacctgtgaaa
ccaaaggaagaggcagtcattcctgaggaagttccagaggttcctaagaaaccagttcct
gaaccactgaaaccaaagaaagaggttccagaaaaagttccagaggttcctaagaagcca
gttcctgaaccattgaaaccaaagaaagaggttccagaaaaagtgccagaggttcccaag
aaacccgttcctgaaccattgaaaccaaagaaagaagttccagaaaaagtgccagaggtt
cccaagaaacccgttcctgaaccattgaaaccaaagaaagaagttccagaaaaagtgcca
gaggttcccaagaaactcgttcctgaaccattgaaaccaaagaaagaggttccagaaaaa
gtgccagaggttcccaagaaacccattcctgaacccttgaaaccaaagatagaggtccca
gaaaaag

DBGET integrated database retrieval system