KEGG   Rhincodon typus (whale shark): 109931231Help
Entry
109931231         CDS       T06055                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: probable glutathione peroxidase 8-B
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp00480  Glutathione metabolism
rtp00590  Arachidonic acid metabolism
rtp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109931231
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109931231
Enzymes [BR:rtp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     109931231
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx Trp_Tyr_perm Ctr
Motif
Other DBs
NCBI-GeneID: 109931231
NCBI-ProteinID: XP_020386152
Position
Unknown
AA seq 89 aa AA seqDB search
MEAVPAFLLKSWTPKGRIFAVFTCMLMCLAALCFLQLKLSKPKNKDFYSFQVLNSKGKLV
SLEKYRGKILQIWNLGGIFGNIXLTQRVR
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagtgcctgctttcctgctgaaatcctggacacccaaaggccgaatcttcgcc
gtcttcacttgcatgctgatgtgcctcgccgcattatgtttcctgcagctcaaactctct
aaacccaaaaacaaagatttttattctttccaagtcctgaattccaaagggaagctcgtc
tccttggaaaaatacagaggcaaaatactacaaatatggaacctcggtggaatttttgga
aatatctagttaacccaaagggtcaggtaa

DBGET integrated database retrieval system