KEGG   Rhincodon typus (whale shark): 109932976
Entry
109932976         CDS       T06055                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp00230  Purine metabolism
rtp00240  Pyrimidine metabolism
rtp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109932976 (dck)
   00240 Pyrimidine metabolism
    109932976 (dck)
Enzymes [BR:rtp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     109932976 (dck)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28 AAA_17
Other DBs
NCBI-GeneID: 109932976
NCBI-ProteinID: XP_020387606
Position
Unknown
AA seq 263 aa
MATPPKRMCVSPNFDDSFEKRVKKISIEGNIAAGKSTFVHMLAKASDEWEVVPEPIGKWC
NVQTMDEFQELTTSQKSGGNLLQMLYDKPSRWAYTFQTYACLSRVRAQLTPLCSKIQEAE
HPVQFFERSVYSDRYIFASNLFESGNLNETEWAIYQDWHGWILNQFGAQIELDALIYLRA
TPEKCMERLYLRGREEEQGIELEYLEKLHYKHECWLYNRTMRLDFEYLKDIPILVLDVNE
DFKDDKIKQEDILDKVKTFLQTL
NT seq 792 nt   +upstreamnt  +downstreamnt
atggctactccgccaaaaagaatgtgtgtcagccccaatttcgacgacagctttgaaaag
agagtgaagaaaatttcaattgaaggaaatattgctgcagggaaatccacttttgttcac
atgttggcaaaagccagtgatgaatgggaagttgttcctgaacctattggcaaatggtgt
aatgttcagacaatggatgaattccaggaacttacaacatcacagaaaagtggcggcaat
ctcctccagatgctctatgacaagccaagtagatgggcgtacacattccaaacttacgct
tgcctgagtagggttcgggcacagcttacgccattgtgctccaaaattcaagaggctgaa
catcctgtacagttctttgaaagatcagtgtacagtgacaggtatatatttgcctccaat
ttgtttgaatctggtaatctgaatgaaacggaatgggcgatttaccaagattggcatggt
tggatactaaaccagtttggtgctcaaattgagttggatgccctgatctaccttcgagca
acccctgaaaaatgtatggagcgcctttatttgagaggcagggaggaggaacaaggaatt
gagttggagtatctagaaaagctgcattacaaacatgaatgttggctttataaccgaaca
atgaggcttgactttgaatacttgaaggacattcctattttagtgcttgatgttaatgaa
gattttaaagacgataaaatcaaacaagaggacattttagacaaggtgaagacattcctg
cagactttgtag

DBGET integrated database retrieval system