KEGG   Rhincodon typus (whale shark): 109933120Help
Entry
109933120         CDS       T06055                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
rtp  Rhincodon typus (whale shark)
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rtp04131]
    109933120
Membrane trafficking [BR:rtp04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109933120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX DOCK-C2
Motif
Other DBs
NCBI-GeneID: 109933120
NCBI-ProteinID: XP_020387690
Position
Unknown
AA seq 394 aa AA seqDB search
SSLPGLKWLDNRKAGFKLELRPVSTVHTQERTLERFFSLCEAVGERYSLIHQTEALSQAV
SMLKLVCLEELVQFLNVVLDKLLPLLHMSCRMGAEGAHVSKEIFDVLVAIVDRLQSSEEV
KKDALGRSHYLASYVHYMFNMPVLHEIRASESEKYATLKPEATAALRRIGLRSTIDPAIQ
PAKPMLLEDRGGSQKHSKLFHEDLAYCIVLTNGQVRDQVYRHLWFFFELLVKSMSQYLSD
MDRWKFPPKQRFSESYRGIVYTMVNIGTEYVKNQDAEITEMTNLSLGFFLNDLLSLMDRG
FVLHLIGHHHKELLENAAAQPHLHDRRINFLRVVCSHEHFVTLNLPLASCSKLQDDNRLL
EDATVHNCPAGMFSLSRRFRQQHFLVGAAPKGDS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
agctcgctgcctggcctgaagtggttggataatcggaaagcaggctttaaattggagtta
cgcccagtttcgacagtgcatacacaggaaaggaccctggagcgattcttctcactgtgt
gaagctgtgggtgaacgttactctttaatccatcagactgaggcactgagccaggccgtc
tccatgctcaagctggtttgcttggaggaattggtccagttcctgaacgtggtgttagat
aaactgctgccactgttacacatgagctgcaggatgggagcagaaggagctcatgtcagc
aaggaaatttttgatgtgctggttgcaattgtggatcgtcttcaaagtagtgaagaggtg
aagaaagacgcattaggccgaagccattatctagcttcgtatgttcactacatgttcaat
atgccagttctccatgagatcagagcctcagagtctgagaaatatgccacactcaagcca
gaggctacagctgcgttacggaggataggactgcgcagcaccattgaccctgcgatccaa
ccagctaaacccatgctgctagaagacagaggaggcagtcagaaacactcaaagttattc
catgaagatttggcctattgcattgtgttaaccaatggacaagtgagagatcaagtttac
aggcatctgtggtttttctttgaactgttggttaaaagtatgagccagtatctctccgac
atggaccgctggaaatttcctccgaaacaacggttctccgagagttaccgcggcattgtc
tacacgatggtcaacattggtacagagtatgtgaaaaaccaggatgctgaaatcacagaa
atgacaaacctgagccttgggttcttcctgaatgacctgctgtccctcatggacagaggc
tttgttcttcatctgattggtcaccaccacaaagagcttctagagaacgctgcagcccag
cctcatctccatgacagacgcatcaacttcctgagggttgtctgcagccacgagcacttt
gtgaccctgaacctaccgcttgcatcatgctccaagcttcaggatgacaacagactctta
gaggatgccactgttcacaactgtcctgctggaatgttcagtctttccaggagattccgt
caacagcacttcctggtgggggctgctcctaaaggagatagctga

DBGET integrated database retrieval system