KEGG   Rhincodon typus (whale shark): 109933135Help
Entry
109933135         CDS       T06055                                 

Definition
(RefSeq) autophagy-related protein 16-1-like isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04136  Autophagy - other
rtp04140  Autophagy - animal
rtp04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109933135
   04136 Autophagy - other
    109933135
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109933135
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rtp04131]
    109933135
   03029 Mitochondrial biogenesis [BR:rtp03029]
    109933135
Membrane trafficking [BR:rtp04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    109933135
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    109933135
Mitochondrial biogenesis [BR:rtp03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    109933135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 ERM DUF4472 SHE3 DUF4082 WbqC TMF_TATA_bd GAS
Motif
Other DBs
NCBI-GeneID: 109933135
NCBI-ProteinID: XP_020387706
Position
Unknown
AA seq 589 aa AA seqDB search
METPSEGTDWRKHIIRQLQHRDLRQKLHFEDLIHSYNQLLMKSDIVQLWRDQHLPSASSL
SPNPQNVVNLQSRHRKELIEMYQANGELAQAVFDLSKQRKHREVELEVSQNRLVELEVKL
SELEGERDRLLARFEEVEEANGRLKKEYDSLQQLYRSQWEQLLKQEVEGTELIQSMIDIK
AQAARDLNYRNEKPKRVKEKNLEKDLAIVSRVPISLDTEVFHPVQKLSPEAVSHQETKIF
KPFQSFRSSSLSLPPHPRLFQSFKDLFRKRANTSFVGVDCNPTNFCSVARVPARVRFSLQ
EAHDGEVNAVKFSPNSKILATGGSDRKVKLWDIVGGMLQKVKTLEGSNDGVTSIEFDPSG
LQLLAGSYDNTARLWSLKDCELKHTLSGHSAKVTAAKFKFYCREAVTGSHDRTIKVWDLS
KAACVSSIPLPSRCSDIVCSDYLIISGHFDEKVRLWDSRSGMKTDEIPLQGKVTSLDINS
ERTQLLSCSRDDLLKVVDLRMNETRQELRAEGFKCGADWTKAIFSPDGSYAIVGSSDGVL
YVWDTLTGKLETSLVGQHRSSINAVSWSLSGEYVVSVDRSRLANLWTDC
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggagactcccagcgaaggcacagactggaggaagcatattatccgacagctccagcac
cgagatctccgccagaaactccacttcgaggatctcattcactcctacaaccagctcctg
atgaaatccgacattgttcaactctggagagaccaacacttaccatctgcttccagccta
tctcccaatccccagaatgtggtgaatttacaaagcagacaccgaaaggaactaatcgaa
atgtatcaggcaaacggagagctcgcgcaggcggtcttcgatctgagcaaacagcgcaaa
cacagagaagtggaactcgaggtcagtcagaacaggttggtggagctggaggtgaagctg
tctgagttggagggagagcgggaccgattgctagcacgattcgaagaggtggaggaagcc
aatggcaggctcaaaaaggagtatgacagccttcagcagctttaccgttcacagtgggaa
caactcctgaagcaggaggtggagggaacagaactgattcagagcatgatcgacatcaag
gctcaagcagcgagagatctcaattatcggaatgagaagccaaagagggtcaaggagaag
aatttggagaaggacttggccattgtttcccgtgtccccatctccttagacacagaagtc
tttcacccagttcagaaactgtcacccgaggcagttagtcaccaggagaccaagatcttc
aaaccatttcagagttttaggtcaagttctttaagcctcccaccccaccccagactcttc
cagtcctttaaagaccttttcaggaagcgggcaaatacatctttcgttggagtggattgc
aatccaacaaacttctgttcggtcgcaagagtcccggctagagttcgattcagcttgcag
gaagcacatgacggtgaggttaatgctgtcaagttttctccaaactccaagatcctggcg
actggaggcagtgacaggaaggtgaagttatgggacattgtcggagggatgcttcagaag
gtgaaaactctggaggggagcaacgatggagtgaccagcattgagtttgacccctcgggt
ctacagctcttagctggatcttacgacaacactgcgcgcctatggagtctgaaggactgt
gagttgaagcacactttgtcaggtcacagtgcaaaggtcacagcggcaaagttcaagttt
tattgtcgagaagctgtcacaggaagccacgacaggacaatcaaagtctgggacctgagc
aaagctgcctgtgttagttcaatccctctcccgtctcgctgcagtgacatygtttgctca
gactacctcatcattagcggacactttgacgagaaggttcgcctgtgggattcgaggtct
gggatgaagactgatgagatcccactgcagggaaaagtgacgtctttagacattaactcc
gaacggacccagttactcagctgttcacgcgacgatctgctaaaggtggtggatctacgg
atgaacgaaaccaggcaggagctcagagctgaagggtttaagtgtggagctgattggacc
aaggcaattttcagccccgatgggagctacgctatagtgggatcatctgatggagttctc
tatgtttgggacaccctcactgggaaactggagacttctttggttggacaacacagatct
tccattaatgcagtttcctggtctttatcgggagagtacgtggtgagcgtggatcggtca
aggttggccaatctctggactgactgctga

DBGET integrated database retrieval system