KEGG   Rhincodon typus (whale shark): 109933509
Entry
109933509         CDS       T06055                                 

Gene name
erap1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
rtp  Rhincodon typus (whale shark)
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rtp01002]
    109933509 (erap1)
Enzymes [BR:rtp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109933509 (erap1)
Peptidases and inhibitors [BR:rtp01002]
 Metallo peptidases
  Family M1
   109933509 (erap1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF3902
Other DBs
NCBI-GeneID: 109933509
NCBI-ProteinID: XP_020388089
Position
Unknown
AA seq 907 aa
MATTGYLKLIGFLTAILTFSITDALQNDQNGKEASDFPFTSDGRMYPWNKMRLPKTIVPV
QYDLVIQPNLTTLNFSASVRIEVLVESDTNSIILHSKNLEIIKATVIPVKKDGTPGLESN
LEILEYPPFEQLALQADAPLYSGNTYLINVDYVANLSESFHGFYKSTFKKQHGEISVLAS
TQFEPTAARMAFPCFDEPAFKAKFSIKIQRESRHIAVSNMPIINSVKLANGLIEDQFDVS
VKMSTYLVAFIVADFKWVSKETKHGVKISVYSVPEKINQTSFALDAAVRLLEFYEDYFNI
SYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLYNAVTSSASDKLGITMIIAHELAHQW
FGNLVTVEWWNDLWLNEGFATFMEIISVNITHPELQVREFFLDRCFSAMEADSFNSSHPV
STPVENPAQIQEMFDNVSYEKGACILNMLMDYLTEDVFKTGIIRYLRCHSYGNAKNEDLW
NSLTNICPSDDTHGSRLSEQQFCLGKSELPPGSQWFMKDVLDVKEMMNTWTLQKGFPLVT
VTVKGRQVLLRQELYQKGSNSQDENSESASYLWQIPLTYITSHSKTVQRHLMRTKNDIIT
LLEEVNWIKFNVDMNGYYIVHYENDGWDALIKLLRERHTVLSSNDRASLINNAFQLVSIG
KLPLDKALDLTLYLKNEVSTMPVFQGMNELVPIYKLMEKREMEEVENQMKTYIVNLFKDL
IDQQSWSDDGSVSERLLRSTLLVFACVREYQPCVDKAEEYFRKWMDSNGTLSLPADVALA
IFTVGAQTTEGWDFLFEKYRHSLFSSEKSKIRAALTISKNTEKLQWLMDQSLQDDIIKTQ
DLPSIVILVNKNPTGHHLAWEFFKKNWNKLIEKFELGSSSIAYTVTGITSQYSTRLTLKR
SKDFLNH
NT seq 2724 nt   +upstreamnt  +downstreamnt
atggcaactactggatatttaaaattgataggattccttacagctatcctcaccttttca
ataacagacgctttacaaaatgaccagaatggtaaggaggcatcagatttcccattcaca
tcagatggtcgaatgtatccctggaacaagatgagattgcctaaaaccattgtccccgta
cagtatgatctggttatccagccaaacttgaccacactgaatttttctgcatctgtaaga
attgaagttttggttgaatcggataccaactctatcattttacacagcaaaaacctggaa
atcatcaaggcaacagtcatacctgtgaaaaaggatggaacacctgggttggaaagcaac
ttggaaattttagaatacccaccatttgagcaacttgcacttcaggcggatgcacccttg
tactcaggaaacacgtacttgatcaatgttgactacgttgccaatctgtcagaaagcttc
catggcttttacaagagcacttttaaaaaacaacatggtgaaataagtgtgttggcatct
acccagtttgagcccactgcagcccgcatggcctttccatgctttgatgaacctgctttc
aaagccaagttttcaatcaaaatacaaagagagtccagacatattgctgtatccaacatg
cccattataaactctgttaaactagccaatggacttatcgaagatcagtttgatgtgagt
gttaaaatgagcacgtaccttgtggcttttatcgtggcagactttaaatgggtcagtaag
gaaaccaagcatggagttaagatttctgtgtactctgtcccagagaagatcaatcagacc
tcatttgctcttgatgcagcagtcagactcctggaattttatgaagactattttaatatt
tcatacccactgcctaaacaagatttggctgctatccctgactttcagtctggggcaatg
gaaaactggggtctgaccacctacagggaatcagcactactttacaatgctgtgacctct
tcagcctctgacaagcttggaatcaccatgatcatagcgcatgaactggctcaccagtgg
tttggaaatttggtaaccgtggagtggtggaatgatctttggctgaatgaaggatttgcc
acgttcatggaaattatctcggttaacatcacacacccagagcttcaagttagagaattc
ttcttggatagatgtttcagtgcaatggaagcagattccttcaattcctcccacccagta
tcaactccagtggaaaaccctgcacagatccaagaaatgtttgataatgtctcctatgag
aagggagcttgcattctgaacatgctgatggactatctgacagaagatgtttttaaaact
ggcattattcgttacctacgttgccatagttatggaaatgcaaaaaatgaggacttgtgg
aacagtctgactaatatttgtccatcagatgatacacatggaagcagactaagtgagcaa
cagttttgcttaggaaagtcagagctacctcctggttcacagtggttcatgaaagatgtt
cttgatgtgaaggaaatgatgaacacatggacacttcagaagggattcccactggttact
gttacagtgaaaggaagacaagtattattacgacaggaactttatcaaaaaggttctaat
tcccaagatgaaaattctgaatctgcaagctatctgtggcagattccactgacttacatt
acaagccattccaaaactgtccagaggcacttgatgagaacaaaaaatgatattatcact
cttttggaggaagtgaattggataaagttcaatgtggatatgaatggctattacattgtt
cattatgagaatgatggatgggatgcattaatcaaattactgagagaacgtcacactgtc
ctcagtagcaacgaccgagccagcctgattaacaatgccttccagcttgtgagtatagga
aagctgcctcttgacaaagcccttgatttgacactttatctgaagaacgaagtcagtact
atgcctgtattccaaggtatgaatgagctcgtacccatttacaagcttatggagaagaga
gaaatggaggaagttgaaaatcaaatgaagacgtacatagtcaacttatttaaggacctg
atagaccagcaatcgtggagtgatgatggctcggtctctgaacggttgctgcgcagtacg
ttgctggtatttgcctgtgttcgcgagtaccagccctgtgttgacaaagcagaggaatac
ttcaggaaatggatggattccaatggtacattgagcttacccgctgatgttgcattagca
attttcacagttggagcccagactacagagggatgggacttcctatttgagaagtacagg
cactcgctttttagctctgagaagagcaagattagagctgccctgacaatcagcaaaaat
acagagaaacttcaatggttaatggaccaaagtttgcaagatgacattatcaaaacacaa
gatctaccttcgattgttatattggtgaacaaaaatccaactggacatcatcttgcttgg
gaattttttaagaagaactggaacaagttaatagaaaagtttgaacttggatcatcttca
attgcatacacagtgactggtattacatctcagtattcaacaaggctcaccttgaagagg
tccaaggattttttgaatcattaa

DBGET integrated database retrieval system