KEGG   Rhincodon typus (whale shark): 109937899Help
Entry
109937899         CDS       T06055                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: N-acetylglucosamine-6-phosphate deacetylase-like
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp00520  Amino sugar and nucleotide sugar metabolism
rtp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    109937899
Enzymes [BR:rtp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     109937899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1
Motif
Other DBs
NCBI-GeneID: 109937899
NCBI-ProteinID: XP_020391989
Position
Unknown
AA seq 209 aa AA seqDB search
MPSNKSVSDAPITQFLNCHILKDHKLQREDLWVREGKILNPEKLFFDEKGYADIQIDCKG
QIIAPGFIDTQINGGYGIDFSTATDDIKCGVSMVARRLLSTGVTSFCPTLVTSPVSIYHR
VIPQIEVKDGSPRGAGILGLHLEGPFISKEKRGAHPEEYLQIFEKHGFQDLLDTYGSLDN
VRIVKLAPELDRSEEVIRELVRRGICVSL
NT seq 628 nt NT seq  +upstreamnt  +downstreamnt
atgccatccaataaatcagtgtccgatgccccaatcacacagttcctgaactgtcatatt
ctaaaggatcacaagttacagagggaggacctatgggtccgtgaggggaagatcctcaac
ccggagaagctgttctttgatgagaaaggttatgcggatattcagattgattgtaagggg
cagatcatcgccccgggctttatcgacacgcagatcaacggaggatatggaattgacttc
tcaacagccacagatgacattaaatgtggggtatccatggttgctcggaggctgctttcc
accggagtgacctccttctgtccaacacttgtgacctccccagtctccatctaccaccgg
gttattcctcaaattgaggtaaaggatggtagtcccaggggagcagggattttgggtcta
cacttggagggtccgttcattagcaaagagaagaggggtgcacatcctgaggaatatctg
cagatatttgaaaagcacgggttccaggatttgttggatacgtatggctccctggacaat
gtccgaattgtcaaattggctcctgaactcgacaggagtgaagaggttatcagggaactg
gtcagacgtgggatctgtgtctcactgg

DBGET integrated database retrieval system