KEGG   Rhincodon typus (whale shark): 109937947Help
Entry
109937947         CDS       T06055                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp00260  Glycine, serine and threonine metabolism
rtp01100  Metabolic pathways
rtp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    109937947
Enzymes [BR:rtp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     109937947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 109937947
NCBI-ProteinID: XP_020392029
Position
Unknown
AA seq 316 aa AA seqDB search
MEDALFVPSGTMGNLISVMCHCQERGAELIVGDQAHIHLYEQGGVAQIAGIHSRVVRNLP
DGTFDLNEVESKIQQHFPDSHYPRTRVICLENTHNEAGGRVLPLSFLQEVRTLADQYKLP
VHVDGARLMNAAVALGVKASEILRFCDSVSMCLSKGLGAPVGSLIGGRREFIDQAVRVRK
VLGGGMRQAGVLAAAGLLSISNMVDRLQDDHRNAKKFAQGVQTFASSICNVGIDAVETNI
LMLAVNDPRISPEEFCDKMAEVTEDEMTVMGRGVRVLMNPVFGRTVRAVWHVDVSEEDTD
LALQKLQYVMQKVHQK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgccttgtttgtacccagtggaacaatgggaaatctcatttcagtcatgtgt
cattgccaggagaggggagctgagctgatagttggtgatcaggcgcatatccatctctat
gaacagggaggtgttgctcagattgctggaattcattcacgtgttgtaaggaatcttccg
gatggaacgtttgatttgaatgaggttgaatcaaaaatacagcagcatttcccagactct
cactaccccaggactcgtgtcatttgcctagagaacactcataacgaggccggagggcgg
gttttaccactctcctttctccaggaggtgcgaactcttgctgaccagtacaagctgcct
gtccatgtggacggagctcgcctgatgaacgcggcggtagctttgggtgtgaaggcctcg
gagatattgcgattctgtgactccgtatccatgtgtctgagcaagggtttaggagctcca
gtcgggtctctcatcggaggccgaagggaatttattgatcaggctgtccgggtgcggaag
gtgcttggagggggcatgaggcaagccggggtgttagctgcagcaggactcctctccatc
tccaatatggttgacaggctccaggatgatcacagaaatgccaagaagtttgcccaaggt
gttcagacgtttgcttcctccatatgcaacgtcggtatcgatgcagtggaaacaaatatt
ctaatgcttgcagtgaacgacccaagaatctcacccgaagaattctgtgacaagatggca
gaggtgacagaggacgaaatgactgtgatgggacgtggtgttcgagtgttaatgaaccca
gtgtttggacgcacggtccgagctgtttggcacgtagacgtatcagaggaggacactgac
ctagcattacagaaattgcagtatgtgatgcagaaggtccatcagaaatag

DBGET integrated database retrieval system