KEGG   Rhincodon typus (whale shark): 109938456Help
Entry
109938456         CDS       T06055                                 

Gene name
erp44
Definition
(RefSeq) endoplasmic reticulum resident protein 44
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
rtp  Rhincodon typus (whale shark)
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rtp04131]
    109938456 (erp44)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rtp04147]
    109938456 (erp44)
Membrane trafficking [BR:rtp04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    109938456 (erp44)
Exosome [BR:rtp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109938456 (erp44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin OST3_OST6 Thioredoxin_2 HyaE Thioredoxin_7
Motif
Other DBs
NCBI-GeneID: 109938456
NCBI-ProteinID: XP_020392449
Position
Unknown
AA seq 407 aa AA seqDB search
MLCLGVQPELLGLPTFLFLLALWFNTSAHSEIVNLDSGNIDEILGNADVALVNFYADWCR
FSQMLHPIFEEASSVVKEEFPDSKHVVFARVDCDQHADIAQRYRISKYPTLKLFRNGMMM
KREYRGQRSVSALADFIKQQKNDPVQEILNLSELETVDRSKRNIIGFFEQRDSDNYRVFE
KVSNILRDDCVFLAAFGSVAKPERYSGDNVIYKPLGENSPDMVYLGSLTNFDLTFAWTQD
KCVPLVREITFENGEELTEEGLPFLILFHLKEDTASLEKFQHETARQLISEKGTINFLHA
DCDKFRHPLLHIHKTPADCPVIAIDSFRHMYLFPNFKDIHTPGALKQFVLDLHSGKLHRE
FHHGPDPTDDAPGQPSEVASSPPESSFQKLAPSEHRYTILKREKDEL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgccttggagttcaacctgaactcttaggccttccaactttcctcttcctcctg
gcattgtggtttaatacatcagctcatagcgaaatagtaaatcttgatagtggaaatatt
gatgaaatcttaggcaatgcagatgttgcactagtcaatttttatgctgattggtgtaga
ttcagtcaaatgttacaccccatctttgaagaggcttcctcggtcgtgaaagaagaattt
ccagactcgaagcatgtagtctttgccagggttgattgtgaccaacatgctgatatagca
caaaggtaccgaattagtaaatatccaacattaaaattattcagaaatgggatgatgatg
aagagagagtacagaggtcaaagatcagtgagtgcacttgcagacttcatcaagcagcag
aaaaatgatcctgttcaagagattctgaatctgagcgaattggaaacagttgatcgcagc
aagcgaaacatcattggattttttgaacagagagattccgacaactacagggtctttgaa
aaagtgtccaatattttacgggatgattgcgtctttctggctgcatttgggagtgttgca
aaaccagagagatatagtggtgacaatgtaatttacaaaccacttggggaaaatagtcct
gacatggtgtatttgggttcattaacaaactttgacctcacgtttgcctggacccaagat
aagtgtgttccactagttagagaaatcacttttgaaaatggtgaggagttaaccgaagag
ggcctgccatttcttatactgttccacttgaaagaagacactgcaagcttagaaaaattt
cagcatgaaaccgcacgacagttgatcagtgagaaaggtactataaacttcctgcatgct
gactgtgacaagttccgtcatcctcttctacatatacacaagacaccagcagattgccca
gttatcgctattgacagctttcggcatatgtatctcttcccaaactttaaagacatacat
actccaggtgcactgaaacaatttgtattagatctacactctggcaaattacatagagag
ttccaccatggcccagatcccactgatgatgctcctggccagccaagtgaagttgcaagc
agccccccagaaagttcattccagaaattagctccaagtgaacacaggtacaccatcctc
aagagagagaaagatgaattatag

DBGET integrated database retrieval system