KEGG   Rhizobium tropici: RTCIAT899_CH00890Help
Entry
RTCIAT899_CH00890 CDS       T02432                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rtr  Rhizobium tropici
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    RTCIAT899_CH00890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGB69598
UniProt: L0LE08
Position
complement(187466..189073)
Genome map
AA seq 535 aa AA seqDB search
MVDLVSNNAEGGNADHPIHGAGSSAKWFLPLFGIVVLAGLVYVAYALGSDLAEAAAVPWI
LLGLALLIALGFEFVNGFHDTANAVATVIYTRSLPAEFAVIWSGFFNFLGVLTSSGAVAF
GILALLPVELILQVGSGSGLAMVFALLTAAIIWNLGTWYLGLPASSSHTLVGSIIGVGLA
NQFLAPAGSATSGVDWSQASSVGMSLLLSPIIGFAAAAILLLVAKVLIRNKELYEAPKGN
TPPPLWIRGLLIFTCTGVSFAHGSNDGQKGMGLIMLILIGLVPTAFALNKTPDVNYLEAY
KAASTQVETVLGKYVKPGVAAPADPKATVSSAVKTKTWTDATTPALQAYIHATSAEIAAY
PSVEKLPNGLVGNVRNDIYLIGESLKLIDKQKLLPMSAEDLKAVTNYHAAVDHATKFIPL
WVKVAVALALGLGTMVGWKRIVVTVGEKIGKTHLTYGQGAAAEVVAMLTIGAADHLGLPV
STTHVLSSGVAGTMAANGSGLQWSTVRNMLMAWILTLPASITLAFVLFIVLRQVF
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacctcgtttcaaacaatgcggaaggcggcaatgccgaccatccgattcatggc
gcaggcagctcggcaaaatggtttctgccactcttcggcatcgtcgtcctggccggcctc
gtctacgtcgcctacgctctcggcagcgatcttgcagaggccgccgcagttccgtggata
ttgctcgggctggcgctgctgatcgcgctcggcttcgaattcgtcaacggcttccatgac
acggccaacgccgttgccaccgtcatctacacgcgctcgctgccagcggagttcgccgtc
atctggtcgggcttcttcaacttcctcggtgttttgacgtcttccggcgccgtcgccttc
ggcatcctggcgctgcttccggtcgagctcatcctgcaggtcggctccggctccggtctc
gcgatggtcttcgccctgttgaccgccgccatcatctggaatctcggcacctggtatctc
ggcctgccggcctcgagctcacatacacttgtcggctcgatcatcggcgtcggcctcgcc
aaccagttcctggcacccgccggttccgccaccagcggtgtcgactggtcgcaggcaagc
agcgtcggcatgtcactgttgctctcgccgatcatcggctttgccgcagctgcaatattg
ctgctggtcgccaaggtgctgatccgcaataaggagctttatgaggcgccgaagggcaac
acgccgcctccgctctggatccgcggcctgctgatcttcacctgcaccggcgtcagcttc
gcccatggctcgaatgacggccagaagggcatgggtctgatcatgctcatcctcatcggc
ctcgtaccgactgccttcgcgctgaataagacgcccgacgtgaactatctcgaagcctat
aaagccgcctcgacgcaagtcgagacggtactcggcaaatatgtgaagccgggcgttgcc
gcaccggccgatccgaaggccaccgtcagcagcgccgtcaagaccaagacctggacggac
gcgacgacgccggctctccaagcatatattcatgccacgagcgccgagatcgcggcctat
ccaagcgtcgagaagctgccgaacgggctcgtcggcaacgtccgtaacgatatctatctg
atcggtgaatcgctgaaattgatcgacaagcagaagctgctaccgatgagcgccgaggac
ctgaaggccgtgaccaactatcacgccgccgtcgatcacgcgaccaagttcatcccgctc
tgggtgaaggttgccgtggcgctggcgctcggccttggcaccatggtcggctggaaacgc
atcgtcgtcaccgtcggcgaaaagatcggcaagacgcacctgacctacggccagggtgct
gccgccgaagtcgtcgccatgctgaccatcggtgctgccgaccatctcggcctgccggtg
tcgactacgcacgtcctgtcctccggcgtcgccggcaccatggcggcaaacggttccggc
ctgcagtggtcgacggtgcgcaacatgctgatggcctggatcctgacgctgccagcttcg
atcacactggccttcgtgctgttcatcgtgctgcgccaggtcttctga

DBGET integrated database retrieval system