KEGG   Rhizobium tropici: RTCIAT899_CH01990Help
Entry
RTCIAT899_CH01990 CDS       T02432                                 

Gene name
gshB
Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
rtr  Rhizobium tropici
Pathway
rtr00270  Cysteine and methionine metabolism
rtr00480  Glutathione metabolism
rtr01100  Metabolic pathways
Module
rtr_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RTCIAT899_CH01990 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RTCIAT899_CH01990 (gshB)
Enzymes [BR:rtr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     RTCIAT899_CH01990 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AGB69816
UniProt: L0LGI7
Position
409089..410036
Genome map
AA seq 315 aa AA seqDB search
MAGIKNVAVQMDHVKSINIAGDSTFAMSLEAQNRGYKLFHYTPERLSMRDGKVYASVEPM
ILRDVKGDHFELGEPERVDLSTMDVVLLRQDPPFDMAYITSTHLLERIHPKTLVVNDPAW
VRNSPEKIFVTEFADLMPKTLITRDPAEIRRFRDEMGDIILKPLYGNGGAGVFHSTRDDR
NLSSLLEMFGQLFREPFIAQQYLPDVRKGDKRIILVDGEAVGAINRVPAEHDARSNMHVG
GRAEATELTAREQEICKRIGPALKERGFLLVGIDVIGDYMTEINVTSPTGIREVKRFGGA
DIASLLWDAIEAKRA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggctggtatcaagaatgttgcggtccagatggaccatgtgaagagcatcaacattgcg
ggtgattccacctttgccatgagcctcgaggcgcagaaccgcggctacaagctcttccac
tatacgccggagcggctgagcatgcgcgatggcaaggtctatgcctccgtcgagccgatg
atcctgcgcgacgtcaagggcgatcacttcgagctcggcgagccggagcgcgtcgatctc
tcgacaatggacgtggtgctgctgcgccaggacccgcctttcgacatggcctatatcact
tcgacgcatctgctcgagcgcatccacccgaagacgctcgtcgtcaatgacccggcctgg
gtccgcaattcgccggaaaagatcttcgtcaccgaatttgccgatctcatgccgaagacg
ctgatcacccgcgatccggctgaaatccgccgcttccgcgatgagatgggcgacatcatt
ctgaagccgctctacggcaatggcggcgccggcgtctttcattcgacccgcgacgaccgc
aatctctcgtctcttctcgaaatgttcggccagctcttccgcgagccgttcatcgcccag
caatatctgcccgacgtgcgcaagggcgacaagcgcatcatccttgtcgatggcgaggcc
gtcggcgcgatcaaccgcgtgccggccgaacatgacgcccgctccaacatgcatgtcggc
ggccgcgccgaagccacggagctgacggcgcgcgaacaggaaatctgcaagcgcatcgga
ccggccctgaaggagcgcggcttcctgctcgtcggcatcgatgtcatcggcgactatatg
accgagatcaacgtgacgtcgccgaccggcatccgcgaagtcaagcgtttcggcggcgct
gatatcgccagcctgctctgggatgcgatcgaagccaagcgggcctga

DBGET integrated database retrieval system