KEGG   Rhizobium tropici: RTCIAT899_CH03060Help
Entry
RTCIAT899_CH03060 CDS       T02432                                 

Definition
(GenBank) fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rtr  Rhizobium tropici
Pathway
rtr00071  Fatty acid degradation
rtr00280  Valine, leucine and isoleucine degradation
rtr00281  Geraniol degradation
rtr00310  Lysine degradation
rtr00362  Benzoate degradation
rtr00380  Tryptophan metabolism
rtr00410  beta-Alanine metabolism
rtr00640  Propanoate metabolism
rtr00650  Butanoate metabolism
rtr00903  Limonene and pinene degradation
rtr00930  Caprolactam degradation
rtr01040  Biosynthesis of unsaturated fatty acids
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
rtr01120  Microbial metabolism in diverse environments
rtr01130  Biosynthesis of antibiotics
rtr01200  Carbon metabolism
rtr01212  Fatty acid metabolism
Module
rtr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RTCIAT899_CH03060
   00650 Butanoate metabolism
    RTCIAT899_CH03060
  Lipid metabolism
   00071 Fatty acid degradation
    RTCIAT899_CH03060
   01040 Biosynthesis of unsaturated fatty acids
    RTCIAT899_CH03060
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RTCIAT899_CH03060
   00310 Lysine degradation
    RTCIAT899_CH03060
   00380 Tryptophan metabolism
    RTCIAT899_CH03060
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RTCIAT899_CH03060
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RTCIAT899_CH03060
   00281 Geraniol degradation
    RTCIAT899_CH03060
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RTCIAT899_CH03060
   00930 Caprolactam degradation
    RTCIAT899_CH03060
Enzymes [BR:rtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RTCIAT899_CH03060
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RTCIAT899_CH03060
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RTCIAT899_CH03060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 NAD_binding_7 UDPG_MGDP_dh_N NAD_binding_8 FAD_binding_3 2-Hacid_dh_C Pyr_redox_2 ApbA GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AGB70026
UniProt: L0LH41
Position
621382..623592
Genome map
AA seq 736 aa AA seqDB search
MAYTNFTVETDADGIALVTWDMPGKSMNVFTAEILEELNAIIDATVADAAVKGVVFTSGK
SSFSGGADLSMIKSMFSFYQEEKAKDPAAATKKLFDLVGRMTGLFRKLETCGKPWVSAIN
GTCMGGAFELSLACHGRVASSAKGVKIALPEVKVGIFPGAGGTQRIARLTDAQSALQMMT
TGQSLTAARAKAMNLLHQVVEPDQLIPAAKQMIKDGLKPVALWDEKGFKAPGGGIWTPAA
AQLWPAAPAILRRETSGNYPAALAILKCVYEGLQVPFDTGLKIEQRYFTHVLQTTEAYSM
IRSLFISMQELGKGARRPTGQPKTELKKVGVVGAGFMGASIAYVTAAAGIPVTLIDRDIE
AATKGKGVGEGLVKDSIGKGRLTQDEGAALLSRITPSADYSDLKDADLVIEAVFEDREVK
KAVIEAVEAVLPAGAVFASNTSTLPITGLAKNSKRPADFIGVHFFSPVEKMMLTEVILGK
ETGDHALAVALDYVAAIKKTPIVVNDTRGFFVNRCVFRYIHEAYDMLIEGVPAAMIENAA
KMAGMPVGPLALNDEVAIDLSYKILKATVADLGEKAVDPRHMQLVTGLVEREGRLGRKNS
KGFYDYPPKPAKKSLWPGLKDLYPQKKADEVDVNVLKQRFLVTIALEAARTIEEGIVTDP
READVGSILGFGFAPYTGGALSYIDGMGVKAFVELCEKLTAAYGPHFQPTALLKDMAAKG
ETFYGRFDPYRAAKAA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcttacacgaatttcaccgtcgaaaccgacgcagacggcatcgcgctcgtcacctgg
gacatgcccggcaagtcgatgaacgtcttcaccgccgagatcctggaagagctgaacgcc
atcatcgacgcgaccgtcgccgatgcggccgtcaagggcgtggtcttcacctctggcaag
tcctccttctccggcggtgccgatctgtcgatgatcaagtcgatgttctctttctatcag
gaggaaaaggcgaaagacccggccgctgccacgaagaagctcttcgatcttgtgggacgc
atgactggcctcttccgcaagctcgagacctgcggcaagccgtgggtttcggcgatcaac
ggcacctgcatgggcggcgctttcgagctgtcgctcgcctgccatggccgtgtcgcttcc
agcgccaagggcgtcaagatcgcgctgcccgaggtcaaggtcggcatcttccccggtgcc
ggcggcacgcagcgcatcgcgcgcctgacggatgctcagtccgcactgcagatgatgacg
acgggccagtcgctgacggcagcacgcgccaaggcgatgaacctcttgcatcaggtggtc
gagccggatcagctgatcccggccgccaagcagatgatcaaggatggcttgaagcctgtg
gcactctgggatgaaaagggcttcaaggcgccgggcggcggcatctggacgccggccgca
gcccagctctggccggcagcgcctgccatcctgcgccgcgagacctcgggcaactatccc
gctgcgctcgccattctcaaatgcgtctatgaaggcctgcaggttcccttcgataccggc
ctgaagatcgagcagcgctatttcacgcatgtgctgcagaccaccgaagcctattcgatg
atccgctcgctgttcatctccatgcaggaactcggcaagggcgcgcgccgcccgaccggc
cagccgaagacggagctcaagaaggtcggtgtcgtcggcgccggcttcatgggtgcgtcc
atcgcctatgtcaccgccgccgcgggcattcccgtcacgctcatcgaccgcgacatcgaa
gccgcgacgaagggcaagggcgtcggcgaagggctggtcaaggattcgatcggtaaggga
aggctgacgcaggatgagggcgcggctctgctctcccgcatcacgccttcggccgattat
tccgatctcaaggatgccgatctcgtcatcgaagcggtgttcgaggatcgcgaagtcaag
aaggccgtcatcgaggccgtcgaggccgtgctgccggccggcgccgtcttcgcctccaac
acctcgactctaccgatcacaggccttgccaagaattccaagcgcccggccgatttcatc
ggcgtccacttcttctcgcctgtggagaagatgatgctgaccgaagtcatcctcggcaag
gagaccggcgatcatgcgctggccgtcgcgctcgattacgtcgcggccatcaagaagacg
ccgatcgtcgtcaacgacacgcgcggcttcttcgtcaatcgctgtgtcttccgctacatc
cacgaagcctatgacatgctgatcgaaggcgtgccggctgcgatgatcgagaatgccgcc
aagatggccggcatgcccgtcgggcctctggcgctgaacgacgaagtcgccatcgacctc
tcctacaagatcctgaaggcgacagtcgccgatctcggcgagaaggctgtcgatccgcgt
catatgcagctcgtcaccggtctcgtggagcgtgagggacgcctgggccgaaaaaactcc
aaggggttttacgactatccgccgaagccggcgaagaagtcgctatggccgggcctcaag
gatctctatccgcagaagaaggccgacgaggtcgatgtcaacgtgctgaagcagcgcttc
ctcgtgaccatcgcactggaggctgcccgcaccattgaagaaggcatcgtcaccgatccg
cgcgaggccgatgttggctccatcctcggcttcggctttgcgccctataccggcggcgcg
ctgtcctacatcgacggcatgggcgtgaaggctttcgtggaactctgcgaaaagctgaca
gctgcctacggcccgcatttccagccgaccgcgctgctgaaggacatggccgcgaagggt
gagaccttctacgggcgcttcgatccctaccgcgccgcgaaagccgcgtaa

DBGET integrated database retrieval system