KEGG   Rhizobium tropici: RTCIAT899_CH05150Help
Entry
RTCIAT899_CH05150 CDS       T02432                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
rtr  Rhizobium tropici
Pathway
rtr00030  Pentose phosphate pathway
rtr00480  Glutathione metabolism
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
rtr01120  Microbial metabolism in diverse environments
rtr01200  Carbon metabolism
Module
rtr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
rtr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
rtr_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RTCIAT899_CH05150
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RTCIAT899_CH05150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rtr04147]
    RTCIAT899_CH05150
Enzymes [BR:rtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     RTCIAT899_CH05150
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     RTCIAT899_CH05150
Exosome [BR:rtr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   RTCIAT899_CH05150
  Exosomal proteins of colorectal cancer cells
   RTCIAT899_CH05150
  Exosomal proteins of bladder cancer cells
   RTCIAT899_CH05150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N DUF637
Motif
Other DBs
NCBI-ProteinID: AGB70438
UniProt: L0LGB6
Position
complement(1055494..1057014)
Genome map
AA seq 506 aa AA seqDB search
MTTPDVAPAPPLTFVIFGAAGDLTRRLLIPTLINMTRSGLIGEDLHILGIGIETGGADML
LDRLESFLKTSGDMDDAERQAAWQSLRKRISYISGDFTQNGVYKEISDYLSHAPSANAAF
YFAVPPRFFGDIAEKLSENGLMNEATGAFRRIAIEKPFGHDLASAQALNARLLNHVSESQ
IYRIDHFLGKETVQNIMTTRFANMMIEALWNNNYIDHVQITAAELVDVGTRGKFYDATGA
LRDMVPNHLFQLLAMVAMEPPNSFDAESIRNEKGKVLKALRVYSREEAIKNGVRGAYTAG
PIAGRDLPAFTQTPDVAPDSDTETFVALKLFVDTWRWASVPFYLRTGKAMKARDTEVVIT
FRPVPFAQFPRHESRPELPPNRLIIQVQPDEGLDMEISIKSPGLVLKTAPVSLDFRYADS
FDIGKQTGYESLFYELFVGDQTLFQRADGIEAGWAAVQPFLDLWAEGGKPDPYAPGSTGP
ACADELIERDGRKWHEIDGTPKGRKI
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccccgacgtcgcaccggccccgccgctaacattcgtgatctttggcgccgcc
ggcgacctcacccggcgcctgctgatcccgacgctgatcaacatgacccgcagcggactt
atcggcgaggatctgcatattctcggcatcggcatcgaaaccggcggcgccgacatgctg
ctggatcgtctggaatcattcctgaagacatcaggcgacatggacgatgcggagcggcag
gcagcatggcagagcctgcgcaagcgcatcagctacatctccggcgatttcacccagaac
ggcgtctacaaggaaatttcggattatctctcgcatgcgccgagcgccaacgcggccttt
tatttcgccgtgccaccgcgcttcttcggcgatatcgccgagaaactctccgaaaacggg
ctgatgaacgaggcgaccggagctttccgccgcatcgcgatcgaaaaacccttcggccat
gatcttgcctcggcacaggctttgaatgcgcggctgctgaaccatgtgtccgaaagccag
atctaccgcatcgaccatttcctcggcaaggaaaccgtgcagaacatcatgacgacacgc
ttcgccaacatgatgatcgaggcactgtggaacaacaactatatcgaccacgtgcagatc
acggcggccgagcttgtggatgtcggcacgcgcggcaaattctacgatgcgaccggcgcg
ctacgcgacatggtgccgaaccatcttttccagctgctggcgatggtggcgatggaaccg
ccgaacagcttcgatgccgaatccatccgcaatgaaaagggcaaagtgttgaaggccttg
cgcgtctactcgcgggaggaagcaatcaagaacggcgtacgcggcgcctatacggccggc
ccgattgccggcagggacctgccggccttcacgcagacacccgatgtcgcgcccgacagc
gacaccgaaaccttcgtggcgctaaagctatttgtcgatacctggcgctgggcaagcgtg
cccttctacctgcgcacgggcaaggcgatgaaggcgcgggatacggaagtggtcatcacc
ttccggccggtgcccttcgcccaattcccccgccacgaatctcgccccgaattgccgccg
aacaggctcatcatccaggtgcagcccgacgaagggctcgatatggaaatctcgatcaaa
tcgccgggcctcgtgctgaaaaccgcgccggtttcgctcgacttccgctatgccgacagt
ttcgacatcggcaagcagaccggatacgaaagcctgttctacgaactcttcgtcggcgac
cagacactcttccagcgcgccgacggcatcgaagccggctgggccgccgtgcagcccttc
ctcgacctctgggcagaaggcggcaaacccgatccttacgcccccggcagcacaggccct
gcctgcgccgacgaactcatcgaacgcgacggccgcaaatggcatgagatcgacgggacg
ccgaagggcaggaagatctga

DBGET integrated database retrieval system