KEGG   Rhizobium tropici: RTCIAT899_CH07855Help
Entry
RTCIAT899_CH07855 CDS       T02432                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase protein
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rtr  Rhizobium tropici
Brite
Enzymes [BR:rtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RTCIAT899_CH07855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_11 MTS RrnaAD Methyltransf_12 Methyltransf_32 Methyltransf_23 Methyltransf_18 PrmA Methyltr_RsmB-F Methyltransf_9 TehB Cons_hypoth95 GidB Ubie_methyltran MetW Methyltransf_PK Methyltransf_15 FtsJ DREV N6_N4_Mtase Methyltransf_4 tRNA_U5-meth_tr CMAS
Motif
Other DBs
NCBI-ProteinID: AGB70967
UniProt: L0LIA4
Position
1597991..1598641
Genome map
AA seq 216 aa AA seqDB search
MDFEAARVKMVENQIRTTDVTSHSVLNAFFAVSRENFVPEKSKLLAYVDCDIEVAPGRFL
MEASPLAKLLQLGAITKDDKVLDVGCGTGYVSAVLSLLAGKVIALESNEELAAQAKANLA
ALGYDNVTVVGGDLEKGHAADAPYDVIFLNGSIEQLPQGLLDQLGEDGRLITVIGYGHAA
RATVFMRERGAFSENVFFNASIKPLPGFAKAKEFVF
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgaagcagcgcgcgtgaagatggtcgagaaccagatccggacgacggatgtc
acctcccattccgtgttgaatgcatttttcgccgtgtcgcgcgaaaatttcgtgccggag
aagtcgaagctcctggcctatgtcgattgcgatatcgaggtcgctcctggccgtttcctg
atggaagcctcgccgctcgcaaagctgctgcagctcggcgccattactaaggatgacaag
gttctcgatgtcggctgcggcacgggttacgtgtccgccgtcctgtcacttctcgccggc
aaggttatcgcgcttgaatccaacgaggagctcgcggctcaggcgaaggccaatctcgcc
gcgcttggctacgacaatgtgaccgtcgttggcggtgaccttgaaaagggtcatgccgcc
gatgcaccctatgatgtgattttcctcaacggttcgatcgaacaattgccgcagggcctg
ctcgaccagctcggcgaagatggccgccttatcaccgttatcggctatggccatgccgcg
cgcgcgaccgttttcatgcgcgaacgcggtgcgttctcggaaaacgtcttcttcaacgcc
tcgatcaagccgctgccgggctttgccaaggccaaggaattcgtcttctga

DBGET integrated database retrieval system