KEGG   Rhizobium tropici: RTCIAT899_CH12620Help
Entry
RTCIAT899_CH12620 CDS       T02432                                 

Definition
(GenBank) two-component response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
rtr  Rhizobium tropici
Pathway
rtr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RTCIAT899_CH12620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rtr02022]
    RTCIAT899_CH12620
Two-component system [BR:rtr02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   RTCIAT899_CH12620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C GerE
Motif
Other DBs
NCBI-ProteinID: AGB71903
UniProt: L0LKG1
Position
2531103..2531804
Genome map
AA seq 233 aa AA seqDB search
MTTKAAISDDAAHLLVVDDDTRIRALLNRYLMEKGFRVTAAADGAEARRKLEGLDFDLII
MDVMMPGESGIALTSSLRAIKNIPIIMLTALAEADSRIAGLEAGADDYLPKPFDPRELVL
RINNILRRNAPADSPKIELVMFGPYTFSLTRKELKKAAELIRLTDREQEIMLLFAKRAGE
TIPRHELIGSDAEVGERTIDVQINRLRRKIEDDPANPIWLQTVRGIGYRLSID
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaaaagcagcaatttcggatgacgcagcacatcttctggtagtggatgacgat
acccgtatccgcgccctcctcaaccgctaccttatggagaagggcttccgcgtcacggct
gccgccgatggcgccgaagcgcgccgcaagctggaagggctcgatttcgatctcatcatc
atggacgtgatgatgcccggcgaatccggcattgcgctgacgtcgagcctgcgggccatc
aagaacattccgatcatcatgctgacggcgctggccgaggccgattcccgaatagccggc
cttgaggccggcgcggatgactatctgccgaaacccttcgacccgcgtgagctggtgctg
cgcatcaacaatatcctgcggcgcaatgcgcccgccgattccccgaagatcgaactggtc
atgttcggcccgtacaccttttcgctcacccgcaaggagctcaagaaggccgccgaactc
atccggcttaccgatcgcgagcaggaaatcatgctgctctttgccaagcgcgccggcgag
acgatcccgcgccatgaactcatcggcagcgacgccgaagtgggagagcggacgatcgac
gtacagatcaaccggctgcgtcgcaagattgaagatgaccctgccaaccctatctggctg
cagacggtgcgtggtatcggctatcgcttgagcatagattga

DBGET integrated database retrieval system