KEGG   Rhizobium tropici: RTCIAT899_CH15165Help
Entry
RTCIAT899_CH15165 CDS       T02432                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rtr  Rhizobium tropici
Pathway
rtr00260  Glycine, serine and threonine metabolism
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
rtr01120  Microbial metabolism in diverse environments
rtr01130  Biosynthesis of antibiotics
rtr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RTCIAT899_CH15165
Enzymes [BR:rtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     RTCIAT899_CH15165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGB72407
UniProt: L0LMD0
Position
3051515..3052561
Genome map
AA seq 348 aa AA seqDB search
MFFASDNWAGAHSKVAERLLAASSGFASAYGTSELDQRVEAKFSEIFEREVAVFFVATGT
AANSLSLASVQKPGGISFCHTEAHVAEDECGAPDFFSGARLATIEGALGKIDPKALATKI
ARFPQDAVHHGRAAAVTITQATEIGTVYSLAEIDAIAAIAKANSLPLHMDGARFANALVA
LGTTPAEMTWKRGVDILSFGGTKNGCWCAEAIVIFDPEKAKEMHFIRKRAAQLFSKSRFI
AAQFDGYFQDGLWLDLARHSNGMADRLRAGLEKTPGARPAWPTTSNEVFAIIPKSAAKAA
EDKGAKFYEWPIPESQPDLVGGDETLIRLVTSFATTEADVGNFLACLG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgttctttgcttccgataactgggccggcgcccattccaaagtcgccgaacgtctgctc
gccgcatcgagtgggtttgcttccgcctacggtacaagcgagctcgaccagcgcgtcgaa
gccaaattctccgagatctttgagcgcgaggtcgcggtcttcttcgtagcaaccggcacg
gccgccaattcgctgtcgcttgccagcgttcagaaaccgggcggcatcagcttctgccac
accgaggcgcatgtcgccgaagacgaatgcggcgctcctgacttcttcagcggcgcgcgt
cttgcgaccattgagggcgccctcggcaagatcgaccccaaggcgcttgccaccaagatc
gcccgcttcccgcaggatgccgtccatcacggccgcgcggctgccgtaacgatcactcaa
gcgacggaaatcggcacagtctattcgcttgccgagatcgacgccatcgcggccatcgcc
aaggcgaacagtctgcccctgcatatggatggcgcgcgtttcgccaacgccctcgtcgcg
ctcggcacgacgccggccgagatgacttggaagcgcggcgtcgatatcctctccttcggc
ggcaccaaaaacggctgctggtgcgccgaggcgatcgtcatcttcgatcctgagaaggcg
aaggagatgcatttcatccgcaagcgcgccgcccagcttttctccaagtcgcgcttcatc
gccgcccagttcgacggctatttccaggacggcctctggcttgatctcgcccgccattcc
aacggaatggccgatcgcctgcgcgctgggctggaaaagacccctggcgctcgcccggcg
tggccgaccacctcgaatgaggttttcgcgatcataccgaagtctgccgccaaggcggcc
gaagacaagggagcgaagttctacgaatggccgatcccggaatcgcagccggatctcgtc
ggcggcgatgaaacgctgatccgcctcgtgaccagcttcgccaccaccgaggctgatgtg
gggaatttcctcgcttgcctgggttga

DBGET integrated database retrieval system