KEGG   Rhizobium tropici: RTCIAT899_CH15260Help
Entry
RTCIAT899_CH15260 CDS       T02432                                 

Gene name
noeJ
Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
rtr  Rhizobium tropici
Pathway
rtr00051  Fructose and mannose metabolism
rtr00520  Amino sugar and nucleotide sugar metabolism
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    RTCIAT899_CH15260 (noeJ)
   00520 Amino sugar and nucleotide sugar metabolism
    RTCIAT899_CH15260 (noeJ)
Enzymes [BR:rtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     RTCIAT899_CH15260 (noeJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AGB72425
UniProt: L0LQN8
Position
3065785..3067212
Genome map
AA seq 475 aa AA seqDB search
MAAKIVPVIMAGGKGTRLWPLSRASAPKQFIQFIGDRTLFQNTLERVADPELYEAPIVLT
NEEFRFLVAEQARELDLKLAAVLLEPVARNTAAAVAAAAALVTELFGKDALMHVLGSDYE
IDANTTYYDCVRLARDTALQGKLVTFGIKPTEPATGYGYIETGKALATGAHAVKRFVEKP
VLEKAKEMVASGSFYWNSGMFMFSAAQLLAEMKEFAPDVEKAASKAVSKSTRDLDFTRLD
ADNFSKSPDISIDYALMEKTANAAVVPSPFTWSDLGSWDAVWKVGSRDESGNVSAGATTL
VNTKNSLVMSHSLHVAVQGLEDVAVIASEDAVYVGHLKDSQEVGKLVKLLASEKKTAKLT
ETHPTSYRPWGGYTSVLNGERFQVKRIFVLPGKKLSLQKHHHRSEHWIVVKGTAEVTVGE
NVQMLRENESIYIPLGEVHRLANPGKILLELIEVQTGSYLGEDDIIRLVDEFGRS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaaaaatcgtcccggtgatcatggcaggcggcaagggtacacggctgtggccg
ctatcgcgcgcttccgccccgaaacaattcatccagttcatcggcgacaggacgctgttt
cagaacactttggagcgggtggccgaccccgaactctatgaagcgccgatcgttctcacc
aatgaggaattccgcttccttgtcgcagagcaggcccgcgaactcgacctgaaactggca
gcggtgctgctggagccggtggcccgcaacacggccgccgcggttgccgccgccgccgcg
ctcgtcaccgagctctttggcaaggacgcgctcatgcatgtcctcggctccgactacgag
atcgacgccaacacgacctactacgactgcgtgcggctggcgcgtgacaccgcgcttcag
ggcaagctcgtaaccttcggcatcaagccgacggagcctgccaccggctacggctatatc
gaaaccggcaaggcgctcgcgaccggcgcccatgccgtcaagcgtttcgttgagaagccc
gtcctggaaaaggcaaaggagatggtggcaagcggcagcttctactggaactccggtatg
ttcatgttctcggccgcccagcttctcgccgaaatgaaggaatttgcacccgacgtcgaa
aaggctgccagcaaggccgtctcgaaatcgacgcgcgacctcgattttacccgcctcgac
gccgacaatttctccaagagcccggatatttccatcgactatgcgctgatggaaaagacg
gccaatgccgccgtcgtcccctcgcctttcacctggtccgatctcggcagctgggatgcg
gtctggaaagtcggcagccgtgacgaaagcggcaacgtgtcggccggtgccacgacgctg
gtcaacacgaagaattcgctcgttatgtcgcacagcctgcacgtcgccgtgcagggcctt
gaggacgtcgccgtcatcgccagcgaagacgccgtctatgtcggccatctcaaggacagc
caggaagtcggcaagctcgtcaagctgctcgcaagcgaaaagaagacggccaaactcacc
gaaacgcatccgacctcctaccgcccctggggcggctatacctcggtgctgaatggcgag
cgcttccaggtgaagcgcatcttcgtgctgccgggcaagaagctctcgctacagaagcat
caccatcgctccgagcattggatcgtcgtcaagggtacggccgaagtaacggtcggcgaa
aacgtacagatgctgcgcgaaaacgaatcgatctatatcccgctcggcgaagtgcatcgc
cttgccaacccgggcaagatcctgctggagctcatcgaagtacaaaccggctcctatctc
ggcgaagacgacatcatccgcctcgtcgacgagttcggcagaagctga

DBGET integrated database retrieval system