KEGG   Rhizobium tropici: RTCIAT899_CH16175Help
Entry
RTCIAT899_CH16175 CDS       T02432                                 

Definition
(GenBank) putative amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
rtr  Rhizobium tropici
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RTCIAT899_CH16175
Enzymes [BR:rtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     RTCIAT899_CH16175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase Mo-co_dimer
Motif
Other DBs
NCBI-ProteinID: AGB72600
UniProt: L0LR84
Position
complement(3271204..3272061)
Genome map
AA seq 285 aa AA seqDB search
MSFKAAAIQMCSGVDPVKNAADMTRLVRDAASKGAIYVQTPEMTGAVQKDRPGLRAVLRD
EPNDIIVKTASELAKELGIHLHIGSTAIALDDGKIANRGFLFGPDGKLINRYDKIHMFDV
DLDNGESWRESAVYRPGSEARIASLPFAELGFSICYDVRFPQLFRAQAVAGAEVMTVPAA
FTKQTGEAHWEILLRARAIENGMFVIAAAQAGKHEDGRETFGHSMIIDPWGKVLASAGGT
GEAVVIAEIDIAAVKSAHDKIPNLKNAREFSLEKIATPAAGGVAA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaaggccgctgccatccagatgtgttccggcgtcgatccggtgaagaacgcg
gctgatatgacccgtttggtgcgggatgcagcctccaagggggcgatctacgtacagacg
ccggagatgaccggcgcggtgcagaaggatcgcccggggctgcgtgccgtgctgcgcgac
gagccgaacgatatcatcgtcaagacggcctccgagctggcgaaggaacttggcatccat
cttcacatcggctcgacggccattgcgctcgatgacggcaagatcgccaatcgcggtttc
ctcttcggtcccgatggcaagctcatcaatcgctacgacaagatccatatgttcgatgtc
gatctcgacaatggcgaaagctggcgcgaaagcgccgtctaccggccgggatcggaagcg
cgcatcgcgtcgctgccgttcgccgagctcggattttccatctgctacgacgtgcgcttt
ccgcagctcttccgcgcccaggccgttgccggcgccgaggtgatgacggtgcctgccgcc
ttcacaaagcagaccggcgaagcgcattgggaaatcctgctgcgcgcccgcgccatcgaa
aacggcatgttcgtgattgccgccgcgcaggccggcaagcatgaggacggccgcgagacc
tttggccattcgatgattatcgatccctggggcaaggtgctggcatccgccggcggtacg
ggcgaagccgtcgtcatcgccgagatcgatatcgccgccgtcaaatcagcccatgacaag
ataccgaacctgaagaatgcgcgtgaattttcgctggagaagatcgcgacgccggcggct
ggaggcgtcgctgcttga

DBGET integrated database retrieval system