KEGG   Rhizobium tropici: RTCIAT899_CH18015Help
Entry
RTCIAT899_CH18015 CDS       T02432                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rtr  Rhizobium tropici
Pathway
rtr00071  Fatty acid degradation
rtr00072  Synthesis and degradation of ketone bodies
rtr00280  Valine, leucine and isoleucine degradation
rtr00310  Lysine degradation
rtr00362  Benzoate degradation
rtr00380  Tryptophan metabolism
rtr00620  Pyruvate metabolism
rtr00630  Glyoxylate and dicarboxylate metabolism
rtr00640  Propanoate metabolism
rtr00650  Butanoate metabolism
rtr00900  Terpenoid backbone biosynthesis
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
rtr01120  Microbial metabolism in diverse environments
rtr01130  Biosynthesis of antibiotics
rtr01200  Carbon metabolism
rtr01212  Fatty acid metabolism
rtr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RTCIAT899_CH18015
   00630 Glyoxylate and dicarboxylate metabolism
    RTCIAT899_CH18015
   00640 Propanoate metabolism
    RTCIAT899_CH18015
   00650 Butanoate metabolism
    RTCIAT899_CH18015
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RTCIAT899_CH18015
   00072 Synthesis and degradation of ketone bodies
    RTCIAT899_CH18015
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RTCIAT899_CH18015
   00310 Lysine degradation
    RTCIAT899_CH18015
   00380 Tryptophan metabolism
    RTCIAT899_CH18015
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RTCIAT899_CH18015
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RTCIAT899_CH18015
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RTCIAT899_CH18015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rtr04147]
    RTCIAT899_CH18015
Enzymes [BR:rtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RTCIAT899_CH18015
Exosome [BR:rtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RTCIAT899_CH18015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C B12-binding ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGB72965
UniProt: L0LS54
Position
complement(3661570..3662751)
Genome map
AA seq 393 aa AA seqDB search
MSSSSIVVASAARTAVGSFNGAFATVPAHELGAAAIKGALERAGVEAKEVDEVILGQVLQ
AGEGQNPARQAAMKAGIPQEATAWGVNQLCGSGLRAVALGLQQIATGDAKIIVAGGQESM
SMAPHAANLRSGTKMGDMKMIDTMIKDGLTDAFYGYHMGITAENIARQWQLSREEQDQFA
VASQNKAEAAQKAGRFKDEIVPFTIQTRKGDVTVDADEYIRLGATMEAMAKLRPAFDKEG
SVTAGNASGLNDGAAAAVLMTETEASRRGIQPLARIVSWATAGVDPQIMGTGPIPASRKA
LEKAGWSVNDLDLVEANEAFAAQACAVNKDLGWDTSIVNVNGGAIAIGHPIGASGARVLN
TLLFEMRRRGARKGLATLCIGGGMGVAMCFEAL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcagttcatccatcgtcgtcgccagcgctgcccgcaccgcggtcggttcgttcaac
ggcgctttcgcgaccgttccggcgcatgaactcggcgctgccgcgatcaagggtgcgctg
gagcgcgccggtgtcgaggccaaggaagtcgatgaagtgatcctcggacaggtgcttcag
gccggcgaagggcagaacccggcccgccaggccgcgatgaaggccggcattccgcaggaa
gcgaccgcatggggcgtgaaccagctgtgcggctcgggcctgcgtgccgtggcgctcggc
ctgcagcagatcgcaaccggtgacgccaagatcatcgtcgccggtggccaggaatccatg
tcgatggcgccgcatgccgcgaatcttcgctccggcaccaagatgggcgacatgaagatg
atcgacaccatgatcaaggacggcctgacggacgccttctacggctaccacatgggcatc
accgccgaaaatatcgcccgccagtggcaactttcgcgcgaggaacaggatcagttcgcc
gttgcctcgcagaacaaggcggaagccgcacagaaggccggtcgcttcaaggacgagatc
gttcccttcaccatccagacgcgcaagggcgacgttacggtcgatgccgatgaatatatc
cgccttggcgcgacgatggaggccatggcgaagctgcgtccggccttcgacaaggagggc
tccgtcaccgccggcaacgcttccgggcttaacgacggtgctgccgctgccgtgctgatg
accgagacggaagcctcgcgccgcggcatccagccgcttgctcgcatcgtctcctgggca
accgccggcgtcgatccgcagatcatggggaccggcccgatcccggcctcccgcaaggcg
ctggaaaaggccggctggtccgtcaacgacctcgatctcgtcgaggccaatgaggcgttt
gccgctcaggcctgcgccgtcaacaaggatctcggctgggatacgtcgatcgtcaatgtc
aacggtggtgcgattgccatcggccatccgatcggtgcttcgggtgctcgcgtcctcaat
acgctgctgttcgagatgaggcgccgcggcgcccgcaagggacttgccacgctttgcatc
ggcggcggcatgggtgtcgccatgtgcttcgaggcgctctag

DBGET integrated database retrieval system