KEGG   Rhizobium tropici: RTCIAT899_CH18445Help
Entry
RTCIAT899_CH18445 CDS       T02432                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
rtr  Rhizobium tropici
Pathway
rtr00330  Arginine and proline metabolism
rtr00332  Carbapenem biosynthesis
rtr01100  Metabolic pathways
rtr01130  Biosynthesis of antibiotics
rtr01230  Biosynthesis of amino acids
Module
rtr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RTCIAT899_CH18445 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    RTCIAT899_CH18445 (proB)
Enzymes [BR:rtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     RTCIAT899_CH18445 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA TruB_C
Motif
Other DBs
NCBI-ProteinID: AGB73047
UniProt: L0LP72
Position
3772146..3773315
Genome map
AA seq 389 aa AA seqDB search
MTARKPLDRYRRIVIKIGSALLVDRKTGLKKSWLDGMCADIAALKAKGIDILVVSSGAIA
LGRSVLDLPSGALKLEESQAAAAVGQISLARAWSESLSHDNIVAGQILLTLGDTEERRRY
LNARATINQLLKIGAVPIINENDTVATSEIRYGDNDRLAARVATMTGADLLVLLSDIDGL
YTAPPHLDRQAKFLDTIAEITPEIEAMAGGAASELSRGGMRTKIDAGKIATGAGCAMIIA
SGKTDRPLKSIESGARSSWFAPSGTPVTARKTWIAGQLQPAGELHVDDGAVTALGAGKSL
LPAGVRRVVGHFGRGDTVAVIGPSGREIARGLVSYDAEEARQITGRKSAEIEAILGYAGR
AAMVHRDDLVMTSSVKTKAEKSKKDEAHA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccgcaagccgctcgaccgctaccgccgcatcgtcatcaagatcggctccgct
ctcctggtcgatcgcaagaccggcttgaagaaatcctggctcgacggcatgtgcgccgat
atcgccgcactgaaggccaagggcatcgatatcctggtcgtctcctcgggcgcaatcgcg
cttgggcgctccgtgctcgacctgccctccggtgcgctgaagctggaagaaagccaggct
gcggcggccgtcggccagatctcgctggcccgcgcctggtcggaaagcctgtcgcatgac
aatatcgtcgccggccagatcctgctgacgctcggcgataccgaagagcgccgccgttac
ctcaacgcccgcgccaccatcaaccagctcctgaagatcggcgccgtgccgattatcaac
gagaacgatacggtcgcgaccagcgaaatccgctatggcgacaatgaccgcctcgcggcc
cgcgtcgcaaccatgaccggcgccgaccttctggtgctgctgtcggatatcgacgggctc
tatacagcgccgccacatctcgaccgccaagcgaaattcctcgatacgatcgccgaaatc
acgcccgagatcgaagccatggccggcggtgccgcttccgagctgtcgcgtggcggcatg
cgcaccaagatcgatgccgggaagatcgcaaccggcgccggctgtgccatgattattgca
tccggaaagaccgaccgaccgctgaaatcaatcgaaagcggcgcccgctcctcctggttt
gcgccatcgggtacgcccgttaccgcccgcaagacctggattgccgggcagttgcagccg
gccggcgaattgcatgtcgacgatggcgccgtgacggcccttggcgccggcaagagcctg
ttgcccgccggtgtgcgccgcgtcgtcggccatttcggccgcggtgacacagtcgccgtc
atcggcccctccggccgggagatcgcccgcggccttgtcagctacgatgccgaagaggcc
cgccagatcaccggccgcaaatcggctgagatcgaggcgatcctcggctatgccggccgc
gccgccatggtgcatcgtgacgaccttgtcatgacgtcatccgtcaagacgaaggccgag
aaatcgaagaaggatgaagctcatgcttga

DBGET integrated database retrieval system