KEGG   Rickettsia typhi TH1527: RTTH1527_00825Help
Entry
RTTH1527_00825    CDS       T01802                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rtt  Rickettsia typhi TH1527
Pathway
rtt00020  Citrate cycle (TCA cycle)
rtt00310  Lysine degradation
rtt01100  Metabolic pathways
rtt01110  Biosynthesis of secondary metabolites
rtt01120  Microbial metabolism in diverse environments
rtt01130  Biosynthesis of antibiotics
rtt01200  Carbon metabolism
Module
rtt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rtt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rtt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RTTH1527_00825
  Amino acid metabolism
   00310 Lysine degradation
    RTTH1527_00825
Enzymes [BR:rtt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RTTH1527_00825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AFE54032
Position
complement(212943..214139)
Genome map
AA seq 398 aa AA seqDB search
MSIKIIIPSLGESVTEATIAKWYKKLGDAVKTDELLLEIETDKVTLEVNAPCNGTIGKIS
KTDGANVTVGEEVGEINEIADTDTAWINNKKQEVSQHTSEQLVDKPAMASNILAPSVQKL
VTENKLDPNNIKGTGRGGRITKYDVLETINTTPITIETHAINKTNEERTQRVRMSRLRKT
IAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHTVKLGFMSFFVKATIEALK
LIPSINAEIDGDDLLYKNYYDIGVAVGTEQGLVVPVIRDADKMSFADIEQAIGNLAKKAR
EGKLSISDLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEIRPM
MYIALSYDHRIIDGKEGVSFLVKIKNLIENPEKLLLNL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaaaattataataccgtcgcttggggagtcagtaacggaagcaactattgct
aaatggtataagaaattaggtgatgcagttaaaactgatgagttattattggaaatcgaa
actgacaaagtgacgttagaagttaatgctccttgcaatggtactatagggaaaatatca
aaaactgacggtgcaaatgtcacagttggcgaagaagtaggtgaaatcaatgaaattgca
gatacagatactgcttggattaataataaaaagcaagaagtttcacaacacacttcagaa
cagcttgtagataaacctgccatggctagtaatattcttgctccttcagtacaaaaatta
gtgaccgaaaacaagcttgatccaaataatattaaaggaactggtagaggtggtagaatt
acgaaatatgatgtactggaaaccataaacactacacctattactattgagactcatgca
ataaataaaactaatgaagaaagaacacaacgcgtgcgtatgtcacgcttgcgtaaaact
attgcacagcgtttaaaagattcacaaaatactgcagctattttgactacttttaacgaa
atcgatatgtcaaaagttattgctttgcgtaatcaatataaagaagagtttgagaaaaag
catactgtaaaacttggatttatgtcattttttgttaaagcaacaattgaagctttaaag
ctgattccatcgataaatgcggaaatagatggagatgatttattatataagaactattac
gatataggtgtagcagtaggaacagagcaaggacttgttgtaccagttattagggatgcc
gataaaatgagttttgctgatatagagcaagctataggaaatttagcaaaaaaagctcgt
gagggaaaactttctatatctgatttgtcaggtggtacattttcaatttctaatggagga
gtatatggctcattattatctacaccgattattaatcctcctcaatcaggtattttagga
ttacataaaaccgaggaaagagctgtagttatagacggtaaaattgaaatacgtccaatg
atgtatatagctttatcttatgatcatcgtatcattgatggaaaagaaggagtatcattc
ttggtaaaaattaaaaatcttattgagaatcctgagaagttattattaaatttgtag

DBGET integrated database retrieval system