KEGG   Rickettsia typhi TH1527: RTTH1527_03115Help
Entry
RTTH1527_03115    CDS       T01802                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rtt  Rickettsia typhi TH1527
Pathway
rtt03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rtt00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RTTH1527_03115 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rtt03011]
    RTTH1527_03115 (rplV)
Ribosome [BR:rtt03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    RTTH1527_03115 (rplV)
  Bacteria
    RTTH1527_03115 (rplV)
  Archaea
    RTTH1527_03115 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AFE54488
Position
complement(825024..825383)
Genome map
AA seq 119 aa AA seqDB search
MIQENKNFATAKAKSIRVSPRKLNLVASFIRNMKVSEALIQLTFSPKRIAKIVKDCLRSA
VANAENNLGLDIDRLIITKATVGKSVVMKRIMPRAKGRATRINKFFSNLDITVTEKEDN
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgatacaggaaaataaaaattttgctacagcaaaagctaagtctattagagtaagtcca
aggaagcttaatttagttgcctcctttattagaaatatgaaagtatctgaagcattaata
caattaactttttctcctaaaagaattgcaaaaattgtaaaagattgtttacgatctgct
gttgcaaatgctgaaaataatttaggtttagacatagataggttaattattactaaagct
actgtaggtaagtcggtcgtaatgaaaaggattatgccgagagcaaaaggaagagcaact
agaataaataagttttttagtaatcttgatataactgttacagaaaaagaggataattaa

DBGET integrated database retrieval system