KEGG   Rickettsia typhi TH1527: RTTH1527_03470Help
Entry
RTTH1527_03470    CDS       T01802                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rtt  Rickettsia typhi TH1527
Pathway
rtt00071  Fatty acid degradation
rtt00280  Valine, leucine and isoleucine degradation
rtt00310  Lysine degradation
rtt00362  Benzoate degradation
rtt00380  Tryptophan metabolism
rtt00620  Pyruvate metabolism
rtt00630  Glyoxylate and dicarboxylate metabolism
rtt00640  Propanoate metabolism
rtt00650  Butanoate metabolism
rtt00900  Terpenoid backbone biosynthesis
rtt01100  Metabolic pathways
rtt01110  Biosynthesis of secondary metabolites
rtt01120  Microbial metabolism in diverse environments
rtt01130  Biosynthesis of antibiotics
rtt01200  Carbon metabolism
rtt01212  Fatty acid metabolism
rtt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rtt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RTTH1527_03470
   00630 Glyoxylate and dicarboxylate metabolism
    RTTH1527_03470
   00640 Propanoate metabolism
    RTTH1527_03470
   00650 Butanoate metabolism
    RTTH1527_03470
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RTTH1527_03470
   00072 Synthesis and degradation of ketone bodies
    RTTH1527_03470
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RTTH1527_03470
   00310 Lysine degradation
    RTTH1527_03470
   00380 Tryptophan metabolism
    RTTH1527_03470
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RTTH1527_03470
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RTTH1527_03470
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RTTH1527_03470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rtt04147]
    RTTH1527_03470
Enzymes [BR:rtt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RTTH1527_03470
Exosome [BR:rtt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RTTH1527_03470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HTH_7
Motif
Other DBs
NCBI-ProteinID: AFE54559
Position
complement(922303..923481)
Genome map
AA seq 392 aa AA seqDB search
MTQQVYITHAKRTAFGSFMGSLSTTPAPMLAAHLINNILQDSKIEPALVNEVILGQVITG
GSGQNPARQTLIYAGIPQEVPGYTINKVCGSGLKSIALAANSIMTCDNEIVIAGGQENMS
LGMHGSYIRAGAKFGDIKMVDLMQYDGLIDVFSGVFMGITAENIAKQFNISRQEQDEFAL
SSHKKAAKAQLLGILQDEILPIEVTVKKTTSLFDHDETVRHDTSIEMLSKLRPAFDKNGV
VTAGNASSINDGAACVLLVSEKALKKHNLTPLARIVSCASAGVDPRIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDIEKVNINGGAIAIGHPIGASGGRILIT
LIHNLRRAKAKKGLVTLCIGGGLGMSMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaggtttatataacacatgccaaaaggactgcattcggatcatttatgggt
agtctgagtacaactccagcaccaatgctagctgctcatttaatcaataatatactgcaa
gatagtaaaatcgaacctgctttagtaaatgaggtaatacttgggcaagtaataacaggt
ggtagtggacagaatccagcaagacaaactctgatttatgctggtataccgcaagaagtg
ccaggttatacgattaataaagtatgcggctcaggtcttaaaagtatagcacttgcagca
aattcaattatgacatgtgataatgaaatagttatagcaggtgggcaggaaaatatgtcg
ctcggtatgcacggtagttatatcagagcaggagctaaattcggtgatatcaaaatggtt
gatctcatgcaatatgacggtttaatagatgtattttcaggagtatttatgggtatcact
gccgaaaatatcgcgaagcagtttaatattagccgacaagaacaggacgaatttgcctta
agttctcacaagaaagctgctaaagcacagttattaggaattttacaagatgaaatcttg
cctatagaagtaacagtaaaaaaaactactagtttgtttgatcatgatgaaacagtaaga
catgatacaagcattgaaatgcttagtaaattacgccctgcttttgataaaaatggtgta
gttactgctggtaacgcttcctctattaatgacggtgcagcatgtgtcctgcttgtttca
gaaaaagctttgaaaaaacataatttaacaccattagctcgtattgtttcttgtgcttca
gctggtgttgatccaagaattatgggtactgcacctgtgccggcatctaaaaaagcctta
agtaaagcaggttggagcgttaatgatttagaagttatcgaggttaatgaggcatttgca
gcacaaagcatttatgtaaaccgtgaaatgaaatgggatatagagaaggttaacataaat
ggtggagcaatagcaattggtcatccgattggtgcaagcggtggacgtattcttataact
ttaatacacaacttacgaagagctaaggctaaaaaaggcttagtgactttatgtatcggt
ggtggtcttggtatgtctatgtgtgttgaagcagtttaa

DBGET integrated database retrieval system