KEGG   Rathayibacter toxicus 70137: TI83_03655Help
Entry
TI83_03655        CDS       T03670                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rtx  Rathayibacter toxicus 70137
Pathway
rtx00450  Selenocompound metabolism
rtx00970  Aminoacyl-tRNA biosynthesis
rtx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TI83_03655
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TI83_03655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rtx01007]
    TI83_03655
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rtx03016]
    TI83_03655
Enzymes [BR:rtx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     TI83_03655
Amino acid related enzymes [BR:rtx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   TI83_03655
Transfer RNA biogenesis [BR:rtx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TI83_03655
 Prokaryotic type
   Other AARSs
    TI83_03655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AJM77300
UniProt: A0A0C5BGF0
Position
805856..807433
Genome map
AA seq 525 aa AA seqDB search
MSDGASFYLTTPIFYVNDVPHIGHAYTEVAADVLTRWHRQAGDDTWLLTGTDEHGQKILR
TATAHGTTPKEWADRLVETAWQPLLTTIDIANDDFIRTTDERHEATVQRFVQKLYDENAI
YTGEYEGYYCVGCEEYKQLSDLEEGTGEVVGKYLCRIHSKPVELLKEKNYFFTMSDYTER
LLELYEERPDFIQPESARNEVIAFVRQGLADLSISRSTFDWGVKVPWDDSHVVYVWFDAL
LNYITAIGYGQNEVEFQRRWPATHIVGKDILRFHAVIWPAMLMAAGLEVPRQVFGHGWLL
VGGEKMSKSKLTGIAPEQITDTFGSDAFRYYFMRAITFGQDGSFSWEDLAARYQAELANG
FGNLASRVIAMLHRYYHGVVPEPGTLSEAETRIQSVVEEAVVSADRSIDALAIHDAITAI
WSIVDELNGYITDQEPWALARSGNGERLGTVLYTASEGLRALAVLLSPVLPRACAALWEA
LGVQDSLGDLTAQRVRQAGQWGQLPVGTTVGALVALFPRIDAPVA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatggcgcctccttctatctcacgactccgatcttttatgtcaacgatgttccg
cacattgggcacgcttataccgaggtcgccgcggatgtgctcacccggtggcaccgtcag
gcgggtgatgacacgtggttactcaccgggaccgatgagcacggtcagaagatcctccgc
actgctactgctcacggtacgacgccgaaggaatgggccgaccgcctggtcgagaccgca
tggcaaccgttgctgacgaccattgatatcgctaatgacgacttcattcgtaccaccgat
gagcggcacgaggctactgtgcagcgctttgtgcagaagctttacgatgaaaatgcgata
tatactggagaatacgagggttattattgcgttggttgcgaggaatataagcagttgtcc
gaccttgaagaaggcaccggcgaagttgtcgggaaatatctctgtcgcattcactccaaa
cccgtcgaattgctcaaagaaaagaactatttctttaccatgagcgactacacggaacgc
cttcttgaactctacgaggagcgtcccgactttatacagccggaatctgcgcgcaacgaa
gtgatcgccttcgttcgtcaggggctcgcagatctctcgatctcgcgctcgactttcgac
tggggggtcaaagtgccgtgggatgactcccacgttgtctatgtctggtttgacgcgctg
ctcaactacatcaccgctatcggttatgggcaaaacgaagtcgaattccagcgtcgatgg
cccgcgacccacatcgtcggcaaagacatcttgcgctttcacgcggtgatctggccggcc
atgctgatggcggccggccttgaggtacctcgccaggtctttgggcatggctggctgctt
gtcggcggcgaaaaaatgtcgaagtcgaaacttaccggaatcgctcccgagcagatcacc
gatactttcggttcggatgcttttcgctactacttcatgcgtgctattaccttcggtcag
gatggttcgttttcctgggaggatttagcggcgcgctatcaggctgaactggccaacggc
ttcggtaaccttgcctcccgtgttattgcgatgctgcaccgctactaccacggcgtggtc
cctgagcctgggacgctatcggaggcggagacgcgaatacagagcgtcgtcgaagaggcg
gtggtctctgccgaccgctcgattgacgccctcgcaatccacgacgccattactgcgatc
tggagcattgtcgacgagctcaacggctacatcaccgaccaggagccgtgggcgcttgcc
agaagcggtaatggggaacggctgggtactgtgctctataccgcgtcggaggggctgcgt
gccctggctgtgttgctctccccggttcttccgcgggcgtgcgcagcgctctgggaggcg
ctcggagtgcaggattcgctgggcgatctcaccgcgcagcgcgtgcgtcaggctgggcag
tggggccagctgccggtcggcacaacggtgggtgccctggtggcgctctttccgcggatt
gatgcgccagtcgcctaa

DBGET integrated database retrieval system