KEGG   Rickettsia typhi Wilmington: RT0181Help
Entry
RT0181            CDS       T00193                                 

Definition
(GenBank) rickettsial conserved hypothetical protein
Organism
rty  Rickettsia typhi Wilmington
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC
Motif
Other DBs
NCBI-ProteinID: AAU03665
UniProt: Q68XH7
Position
230866..231252
Genome map
AA seq 128 aa AA seqDB search
MLIFLEVKYMNFHNRKLDEELIDYNISLRILFTILSVAIIMVAFDSLATSVSDPVGDALC
KLIKVFRGNTAKGIAVVGIIVLGIQTLRGKLQWEVALVVVTAIIILFKAPDIVNMVSSDN
NSSNCGVS
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgctaatttttcttgaggtaaaatatatgaactttcataatcgtaaattagacgaagaa
ttaatcgattataatatatcattacgtatattatttactattctaagcgtagctattatt
atggtggcttttgatagtttagccactagtgtgagcgatcctgtaggtgatgcattatgt
aagttaattaaagtatttagaggcaatactgcgaaaggtatagctgttgtaggtataatt
gttttaggaattcaaacattaagaggaaaattgcagtgggaagtagctttagtagtagtt
actgcaataattatattatttaaagcaccagatattgtgaatatggtgtcaagtgataat
aatagctcaaattgtggtgtttcttaa

DBGET integrated database retrieval system