KEGG   Rickettsia typhi Wilmington: RT0212Help
Entry
RT0212            CDS       T00193                                 

Gene name
thrS
Definition
(GenBank) Threonine translase
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
rty  Rickettsia typhi Wilmington
Pathway
rty00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rty00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RT0212 (thrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rty01007]
    RT0212 (thrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rty03016]
    RT0212 (thrS)
Enzymes [BR:rty01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     RT0212 (thrS)
Amino acid related enzymes [BR:rty01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   RT0212 (thrS)
Transfer RNA biogenesis [BR:rty03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    RT0212 (thrS)
 Prokaryotic type
    RT0212 (thrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon tRNA_SAD TGS tRNA-synt_2 GIT_CC
Motif
Other DBs
NCBI-ProteinID: AAU03694
UniProt: Q68XE8
Position
272365..274272
Genome map
AA seq 635 aa AA seqDB search
MINISFPDGSVKQFAQNITAFEIANAISMSLAKAAMVVEINGEFKDLSTVIEHDCKLRIL
TAKDYECLEIIRHDAAHLTAAAVKELFPETQVAIGPAIENGYYYDFARDKPFSRDDLATI
EAKMQELVKKNEKITRELWDRDKAIEFFLSIGEHYKAKIIASIPAGEQITLYRQGNFIDL
CRGPHAPSTGFVKYFKLMKVAGAYWRGNSRNEMLQRIYGTAWATKEQLDNYLFMLEEAEK
RDHRKIGKELDLFHFQEEAQGMVFWHDKGWSIYNTIEQYIRKKNRKNGYIEVKTPVLVDK
SLWEASGHWAKFRCDMFTLETDDKILALKPMNCPCHVQIFKQGIKSYRDLPLRMSEFGLC
HRNEASGALHGLMRVRSLVQDDAHIFCAEEQITDETVRFCKLLTEVYKDFGFTDIKVKFS
DRPEIRAGNDEVWDKAEHALKTAVEKVGFIYTLNPGDGAFYGPKLEFVLTDAIGRQWQCG
TLQMDFVLPERLDANYIAASGEKKRPVMLHRAILGSLERFIGILIEEYAGKFPIWLAPVQ
VAIATITNDLNDYALEVQKTLIDNNIRTDINISPDKINYKIREFSNQKIPMIAVIGKKEQ
ANKQVTIRKFGTTGQEILSIEQLIAMIKKENSNYL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgattaatatatcttttcctgacggtagtgtaaaacaatttgcacaaaatattaccgct
tttgaaatagcaaatgcaatttcaatgtcacttgctaaggcagcaatggttgttgaaata
aacggtgaatttaaagatttaagtactgtaattgagcatgattgtaagcttcgtatttta
actgcgaaagattatgaatgtcttgagataataaggcacgatgcagcacatttaacagca
gcagcagtaaaagaacttttccctgaaactcaggtagcgattggtcctgcaattgaaaat
ggttattattatgattttgctcgtgataaacctttttcgcgagatgatttagctactata
gaagctaaaatgcaagaacttgtaaaaaagaatgagaaaataacacgagaattatgggat
agggataaagctatagagttttttttatctataggagagcattataaagccaaaattatt
gcttcaatcccggcaggtgaacaaattactttatacagacaaggtaattttattgatttg
tgtcgagggcctcatgctccttctacagggtttgttaagtattttaaactgatgaaagtt
gcaggagcttattggcgaggcaatagtcgtaatgaaatgttacagcgtatatatggtaca
gcatgggctactaaagaacagcttgataattacctttttatgcttgaagaagcagaaaaa
cgcgatcataggaagatagggaaagaacttgacttattccattttcaagaggaagcacaa
ggtatggtattttggcatgataaaggctggagtatatataataccattgagcaatatata
agaaaaaaaaatcgtaaaaatggatatattgaagttaaaactcccgttttagttgacaaa
agcctttgggaagcttcaggacattgggcaaagtttcgttgtgatatgttcacattagaa
acagatgataagatattagctttaaagcctatgaactgtccttgtcatgttcagattttc
aagcaaggtattaagagttatcgtgatttacctttgcgtatgtcagagtttgggttatgt
catcgtaatgaagcgtctggtgcattgcacggtttaatgagggtgcgtagtttagtacaa
gatgatgctcatatattttgtgctgaggagcaaattacagatgaaacagtacgtttctgt
aagttactgacagaggtttataaggattttgggtttactgatatcaaggtaaaattttcc
gatcgtcctgaaattcgtgcaggtaatgatgaagtgtgggataaggctgagcatgctttg
aaaacagcggtagaaaaagtagggtttatttatacgctaaacccaggtgatggtgcattt
tatggcccgaagcttgagtttgtattaacagatgcgatagggcggcaatggcaatgtggt
acactgcagatggattttgtattaccggagcggttagatgctaattatattgctgcaagt
ggtgagaaaaaaagacctgtaatgttacatagggcaatccttggttcacttgagcgtttt
attggtatcttgatcgaagaatatgcaggtaagttccctatttggcttgcaccagtacaa
gttgccattgcaaccattactaatgatttaaacgattacgctttagaagtacaaaaaacc
ttaattgataacaatataagaacggatattaatatttctcctgataagattaactataag
attcgagagttttctaatcaaaagataccgatgattgctgtaattggtaagaaagaacaa
gcaaataaacaagtaacgataagaaaatttggtactactggacaggaaatattatcgata
gaacagttaatagctatgattaaaaaagagaatagtaattatttgtaa

DBGET integrated database retrieval system