KEGG   Rickettsia typhi Wilmington: RT0315
Entry
RT0315            CDS       T00193                                 

Name
(GenBank) BioY family protein
  KO
K03523  biotin transport system substrate-specific component
Organism
rty  Rickettsia typhi Wilmington
Pathway
rty02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rty00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RT0315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rty02000]
    RT0315
Transporters [BR:rty02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Biotin transporter
    RT0315
   Energy-coupling factor transporter
    RT0315
SSDB
Motif
Pfam: BioY
Other DBs
NCBI-ProteinID: AAU03795
UniProt: Q68X47
Position
397709..398281
AA seq 190 aa
MNSLFKILYLNRFVAHLNTNTYILDIVKIVIGVVAIFASAQITIPIKPVAITMHSVILCI
IAFTYSPRLSFLTILTFIFIGIMGLPVFCQFSSGINYFLGAAGGYYLGFLIGIPVMSVLK
GKLAENWVNVTIICIIGHIIFYLCGVIWLASIIGLKQAIYSGFVIFIPSGLAKLLIFSCL
FSYIKNIKSK
NT seq 573 nt   +upstreamnt  +downstreamnt
atgaattctctatttaaaatattgtatctgaatagatttgtcgcacatttaaatacaaat
acttatattctagatattgtgaaaatagttattggagtagttgcaatttttgcttcagca
caaatcactattcctataaaacctgtagcaattacaatgcatagcgtaatactttgtatt
atcgcttttacatatagtccacgtcttagttttctcactattttgacttttatttttata
ggtataatgggtttgccggtattctgtcaattttctagcggaataaattactttttagga
gcagcaggtggttattacctcggatttttaatcggaattcctgttatgagtgttttaaag
ggtaagttggctgagaattgggtaaacgttactataatttgtattatcggtcatattata
ttttatctatgcggtgttatctggcttgccagtattataggtttaaagcaggcaatttat
agtggttttgtaatttttattccaagcggtcttgctaaacttcttatcttctcttgctta
ttttcttatattaagaacataaaaagcaaataa

DBGET integrated database retrieval system