KEGG   Rickettsia typhi Wilmington: RT0547Help
Entry
RT0547            CDS       T00193                                 

Gene name
fadB
Definition
(GenBank) Beta-hydroxyacyl dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rty  Rickettsia typhi Wilmington
Pathway
rty00071  Fatty acid degradation
rty00280  Valine, leucine and isoleucine degradation
rty00281  Geraniol degradation
rty00310  Lysine degradation
rty00362  Benzoate degradation
rty00380  Tryptophan metabolism
rty00640  Propanoate metabolism
rty00650  Butanoate metabolism
rty00903  Limonene and pinene degradation
rty00930  Caprolactam degradation
rty01040  Biosynthesis of unsaturated fatty acids
rty01100  Metabolic pathways
rty01110  Biosynthesis of secondary metabolites
rty01120  Microbial metabolism in diverse environments
rty01130  Biosynthesis of antibiotics
rty01200  Carbon metabolism
rty01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rty00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RT0547 (fadB)
   00650 Butanoate metabolism
    RT0547 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    RT0547 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    RT0547 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RT0547 (fadB)
   00310 Lysine degradation
    RT0547 (fadB)
   00380 Tryptophan metabolism
    RT0547 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RT0547 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RT0547 (fadB)
   00281 Geraniol degradation
    RT0547 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RT0547 (fadB)
   00930 Caprolactam degradation
    RT0547 (fadB)
Enzymes [BR:rty01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RT0547 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RT0547 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RT0547 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_2 ECH_1 NAD_binding_2 NAD_Gly3P_dh_N UDPG_MGDP_dh_N NAD_binding_8 ApbA Pyr_redox_2 DAO
Motif
Other DBs
NCBI-ProteinID: AAU04015
UniProt: Q68WH7
Position
complement(705855..708017)
Genome map
AA seq 720 aa AA seqDB search
MQNEIKKVCVIGAGVMGSGIAALIANSSHRVVLLDILDKDSNDPNKIVKNAVKNLHRQKL
PPLSYPDKVNFITIGNLEHDLDLIKECNLVIEVIVEKLDIKHQLYNKIIPYLKEDTIIAS
NTSTLPLKKLKENLPNNIKSRFIITHFFNPPRYMELVELIIDNTIKDEVIEKISVFLTKI
LGKTIIKCNDTPGFIANRVGCFLLELVAHKAIAQNLDFVTIDQIFSRCLGLPNTGIFGLY
DLIGHDVMKLISSSLLSALPKSDDYHRIYFNTKVFDKMIEHNLIGRKGEGGFYRLSVSNG
KKIKEVINISDLSYHPVQKVDISFNNLDELLASDSIYSKFFSEIITEFYIYLTSLVPSVT
NNIYDIDATMKLGYSWHYGPFELLTIAVKNGWNSIIKNADLMNISLPKYLASKEYQKIDK
QKFNSKKDFLQESTIVLANDSANLIHYCENLIFVITTKMNTLNHNVFYLLQEAVSKAENY
GKNLYIFPQGNNFSAGADLKLILSYIQDGNFDNLENLLKLGQQTMRYLKYSSVHIISCAR
GVALGGGCELLLNSSYIVANQELNAGLIEFGVGLIPGWSGVTEMFARSNGDKTKLIRNIK
NIIEQNKTSSADYFKADYDVSNMQVNMNKHYILDEALKLNVSNKIVSIPHKIALPKINIV
SEIDTSKYNDLQNKVLNKFQNIIDKHNEISEAELLTYEREIFLELAKEPQTIEKLHAIVG
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgaaataaaaaaagtttgtgttattggtgcaggagttatggggtcaggaatt
gcagcgttaattgctaattcttctcaccgagtagttttgcttgatattctcgataaagat
tctaatgatcctaataaaatagtaaaaaatgctgtaaagaatttgcatagacaaaaactt
cctccattatcttatccagataaagtaaatttcattacaataggtaatttagaacatgat
ttagatttaattaaagaatgtaatttagtaattgaagttattgttgagaagttagacatc
aaacatcaattatataataaaattataccttatcttaaagaagacacaattattgcttct
aatacctctacattgccactgaaaaaactcaaagagaatttaccgaataatataaagtcc
aggttcattattacgcatttctttaatccaccgagatatatggagttggttgaattaatt
atagacaatacaatcaaggatgaggtaatagagaaaatatcagtgttcttaacaaaaatt
cttggtaaaactataataaaatgtaatgatacacctggttttattgctaatagagtaggg
tgttttttacttgagttagtagcccacaaagcgatagctcaaaatcttgattttgttaca
atcgatcaaatatttagtagatgtttaggtttgccaaataccggaatttttggcttatat
gatttaataggtcatgacgtaatgaagttaatatcaagttcattactttctgctctgcct
aaaagtgatgattatcataggatatattttaataccaaagtttttgataagatgatagag
cataatttaattggacgtaaaggtgagggtggattttatcgtttatctgtatcaaatggt
aaaaagattaaagaagttattaatataagtgatttatcatatcaccctgttcagaaagta
gatatttcatttaataatcttgatgagttgttagctagcgattcaatttatagcaagttt
tttagtgagattatcacagaattttatatttatttaacaagcttagtaccatctgtgact
aataatatctacgatattgatgctactatgaagcttggttatagttggcattatggaccg
tttgagttattgactatagctgttaaaaatggatggaattcgataattaaaaatgctgat
ttaatgaatatttcactacctaaatatttagctagtaaagaatatcaaaaaattgataaa
caaaaatttaattctaaaaaagattttttacaagaaagtacaatagtattagcaaatgat
tctgcaaatttaatacattattgtgaaaatttaatatttgttattactacgaaaatgaat
actttgaatcataatgtgttttatttattgcaagaagcagtaagtaaagcagaaaattat
ggaaaaaatctttatattttcccacaaggaaataatttttctgctggtgcggatttaaag
cttattctttcttatattcaagatgggaattttgataatttagagaatttattaaagctt
ggacaacaaacaatgcgttatttaaaatattcctctgtacatattattagctgtgctcgt
ggtgttgcgcttgggggtgggtgtgaacttctattaaactcaagctatattgttgcaaat
caggagcttaacgccggacttatagagtttggagtaggtttaataccaggatggagtggt
gttacagaaatgtttgctagaagtaatggagataaaactaaattaattagaaatattaag
aatattatagagcaaaataaaacaagttcagctgattattttaaagcagattatgatgta
agtaatatgcaagtcaatatgaacaagcattatattttagatgaagctttgaaactaaac
gtatctaacaaaatagtatcaatacctcataaaattgctttacctaaaattaatatagta
agtgaaatagatacatccaaatataatgatctacaaaataaggtacttaataaattccag
aatattattgataaacataatgaaataagtgaagcagaattacttacatatgagcgtgaa
atatttttagaacttgcaaaagaaccgcagactatagagaaattgcacgcgattgtgggg
taa

DBGET integrated database retrieval system