KEGG   Rickettsia typhi Wilmington: RT0722Help
Entry
RT0722            CDS       T00193                                 

Gene name
fadA
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rty  Rickettsia typhi Wilmington
Pathway
rty00071  Fatty acid degradation
rty00280  Valine, leucine and isoleucine degradation
rty00310  Lysine degradation
rty00362  Benzoate degradation
rty00380  Tryptophan metabolism
rty00620  Pyruvate metabolism
rty00630  Glyoxylate and dicarboxylate metabolism
rty00640  Propanoate metabolism
rty00650  Butanoate metabolism
rty00900  Terpenoid backbone biosynthesis
rty01100  Metabolic pathways
rty01110  Biosynthesis of secondary metabolites
rty01120  Microbial metabolism in diverse environments
rty01130  Biosynthesis of antibiotics
rty01200  Carbon metabolism
rty01212  Fatty acid metabolism
rty02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rty00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RT0722 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    RT0722 (fadA)
   00640 Propanoate metabolism
    RT0722 (fadA)
   00650 Butanoate metabolism
    RT0722 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    RT0722 (fadA)
   00072 Synthesis and degradation of ketone bodies
    RT0722 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RT0722 (fadA)
   00310 Lysine degradation
    RT0722 (fadA)
   00380 Tryptophan metabolism
    RT0722 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RT0722 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RT0722 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RT0722 (fadA)
Enzymes [BR:rty01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RT0722 (fadA)
Exosome [BR:rty04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RT0722 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HTH_7
Motif
Other DBs
NCBI-ProteinID: AAU04179
UniProt: Q68W13
Position
complement(921426..922604)
Genome map
AA seq 392 aa AA seqDB search
MTQQVYITHAKRTAFGSFMGSLSTTPAPMLAAHLINNILQDSKIEPALVNEVILGQVITG
GSGQNPARQTLIYAGIPQEVPGYTINKVCGSGLKSIALAANSIMTCDNEIVIAGGQENMS
LGMHGSYIRAGAKFGDIKMVDLMQYDGLIDVFSGVFMGITAENIAKQFNISRQEQDEFAL
SSHKKAAKAQLLGILQDEILPIEVTVKKTTSLFDHDETVRHDTSIEMLSKLRPAFDKNGV
VTAGNASSINDGAACVLLVSEKALKKHNLTPLARIVSCASAGVDPRIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDIEKVNINGGAIAIGHPIGASGGRILIT
LIHNLRRAKAKKGLVTLCIGGGLGMSMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaggtttatataacacatgccaaaaggactgcattcggatcatttatgggt
agtctgagtacaactccagcaccaatgctagctgctcatttaatcaataatatactgcaa
gatagtaaaatcgaacctgctttagtaaatgaggtaatacttgggcaagtaataacaggt
ggtagtggacagaatccagcaagacaaactctgatttatgctggtataccgcaagaagtg
ccaggttatacgattaataaagtatgcggctcaggtcttaaaagtatagcacttgcagca
aattcaattatgacatgtgataatgaaatagttatagcaggtgggcaggaaaatatgtcg
ctcggtatgcacggtagttatatcagagcaggagctaaattcggtgatatcaaaatggtt
gatctcatgcaatatgacggtttaatagatgtattttcaggagtatttatgggtatcact
gccgaaaatatcgcgaagcagtttaatattagccgacaagaacaggacgaatttgcctta
agttctcacaagaaagctgctaaagcacagttattaggaattttacaagatgaaatcttg
cctatagaagtaacagtaaaaaaaactactagtttgtttgatcatgatgaaacagtaaga
catgatacaagcattgaaatgcttagtaaattacgccctgcttttgataaaaatggtgta
gttactgctggtaacgcttcctctattaatgacggtgcagcatgtgtcctgcttgtttca
gaaaaagctttgaaaaaacataatttaacaccattagctcgtattgtttcttgtgcttca
gctggtgttgatccaagaattatgggtactgcacctgtgccggcatctaaaaaagcctta
agtaaagcaggttggagcgttaatgatttagaagttatcgaggttaatgaggcatttgca
gcacaaagcatttatgtaaaccgtgaaatgaaatgggatatagagaaggttaacataaat
ggtggagcaatagcaattggtcatccgattggtgcaagcggtggacgtattcttataact
ttaatacacaacttacgaagagctaaggctaaaaaaggcttagtgactttatgtatcggt
ggtggtcttggtatgtctatgtgtgttgaagcagtttaa

DBGET integrated database retrieval system