KEGG   Ruegeria sp. AD91A: D1823_08425Help
Entry
D1823_08425       CDS       T05627                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
rua  Ruegeria sp. AD91A
Pathway
rua00860  Porphyrin and chlorophyll metabolism
rua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rua00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D1823_08425
Enzymes [BR:rua01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     D1823_08425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: AXT26603
UniProt: A0A346SGU0
Position
1687506..1688963
Genome map
AA seq 485 aa AA seqDB search
MVRAIMIQGTGSNVGKSVLVAGLARAYTRRGLRVAPFKPQNMSNNAAVTENGGEIGRAQA
LQARAARRTPHTDMNPILLKPETDTGAQIIVQGQRAGMMKAGDYRKDKSKLLGAALESFD
RLCADADLVLIEGAGSPAETNLRKGDIANMGFACAAEIPVVLVGDIHRGGVIAQIVGTQV
VLDEGDRAQIKGFAVNRFKGDVSLFDEGREDISARTGWPCLGVVPWFHDAWKLPAEDMMD
IRSHTGGVSKVVVPQLERMANFDDLDPLSAEPGVSVEIIPGGRPLPGDADLVLLPGSKST
IGDLTYFRAQGWDIDLYAHVRRGGHVLGLCGGYQMLGKTISDPDGVDGRPGKIDGLGLLN
VDTVMGGQKQVILRSAHALPDLEPVSGYEIHMGHTDGPDRARAWLEVEGRPEGAASSNGR
VKGSYLHGIFSSDAFRARYLSTLGVTSDIAYEDGVEQALNDLADHLERHMNLDLLLSLAQ
PPQRG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggttcgcgccatcatgattcaaggcaccggcagcaatgtcggaaaatcagttctggtg
gccgggctggcgcgcgcctacacgcgtcgggggcttcgggtcgcgccgttcaaaccgcaa
aacatgtcgaacaacgctgccgtcaccgaaaacgggggcgaaattggccgcgcgcaggcc
cttcaggcccgtgcggcacggcggacaccccacacggacatgaaccctattctgctgaaa
cctgaaaccgataccggcgcgcagatcatcgttcaggggcagcgcgctggcatgatgaag
gccggagattaccgcaaggacaaatccaagctattgggagcagcgctggaaagctttgac
aggctctgcgccgacgctgatctggttctgatcgagggcgctggcagcccggctgagacc
aacctgcgcaagggtgacatcgccaatatggggtttgcctgtgccgcggagataccagtg
gttctggtcggggacattcatcggggcggggtgattgcgcagatcgttggcactcaggtc
gtgctggacgaaggagaccgggcgcagatcaagggttttgcggtcaatcgtttcaaagga
gatgtgtccctgtttgacgaagggcgcgaagacatctccgcacgcaccggatggccttgt
ctgggagtcgtgccatggtttcacgacgcatggaaactgcccgccgaggacatgatggac
atccgttcccataccggcggcgtgagcaaggtcgttgtgcctcagcttgagcgaatggcg
aatttcgacgatctcgatccgttgtccgccgaacccggcgtaagtgtcgagatcatccct
ggcggacgccccctgcccggcgacgccgatctggttctgctgcccggaagcaaatccaca
atcggagacctgacctatttccgggcacagggctgggatatcgacctctatgcccatgtt
cgccggggcggacatgtcctggggttgtgcggtggctatcagatgctgggcaaaaccatt
tccgatcccgatggcgtggatggccggccaggcaagattgatggattgggattgttgaac
gtcgataccgtcatgggcggccagaaacaggtcattctgcgttcggcccatgccctgccc
gacctggaaccggttagcgggtacgaaatccacatgggtcacaccgacggcccggaccgc
gcccgcgcctggctggaagtcgaaggcagaccagaaggtgcggccagcagcaacggccgg
gtcaaaggcagctatctgcatggcattttctcgtcagacgcatttcgcgcccgctacttg
tcaacgctgggcgtgacgtcggacattgcttacgaagacggtgtagagcaggcgctgaac
gatcttgcggatcatctggaacgccacatgaatcttgacctgctgctaagtctggctcag
ccaccgcagcgtggctga

DBGET integrated database retrieval system