KEGG   Ruegeria sp. AD91A: D1823_09350Help
Entry
D1823_09350       CDS       T05627                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rua  Ruegeria sp. AD91A
Brite
KEGG Orthology (KO) [BR:rua00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    D1823_09350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AXT28537
UniProt: A0A346SMC4
Position
1869978..1871453
Genome map
AA seq 491 aa AA seqDB search
MSDTNPKPRWQKLDSDLHRISRIEAANIHVARHLLAPGVALAFMALAGLTAAVLFGQADG
SYIVVAAAAFGAYMAINIGANDVANNMGPAVGANVLTMGGAIVIAAIAESTGALLAGGDV
VSTISKGIIDPASVQNSEVFIWAMMAALISSAMWVNLATWIGAPVSTTHSVVGGVMGAGI
AAAGLSAVSWGTMSAIAASWVISPVLGGVIAAGFLALIRSKIQHQDDKIAAARKWVPILL
AVMAGAFSTYMSVKGLKRIVTIDLEMALLIGLSVGLLAWSVTVPWVKRKSEGMENRTRSL
KTLFGLPLVISATFLSFAHGANDVANAVGPLAAIVHAAEFGEFAAKVSIPLWVMIIGAFG
ISFGLFLFGPRLIRMVGSQITKLNPIRAFCVALSAAITVILASWLGLPVSSTHIAVGAVF
GVGFYREWHSERRRKQGNLQRTAQHLAPEEYRRRKLVRRSHFMTIVAAWVVTVPAAATMS
AVIYWVLTAFV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacacgaatccaaaaccacgctggcaaaagctagacagcgacctgcaccgaatt
tcgcgtatcgaagccgccaatatccatgtcgcacgccatttgctggcaccgggagtcgcg
ctggccttcatggcattggccgggctgacggcggcagttctgtttggtcaggcggatggt
agctatatcgtcgtcgcagcggctgcgttcggggcctatatggcaatcaatattggcgcc
aatgacgtggccaacaatatgggccctgcggttggtgcgaatgtgctcaccatgggcggc
gccatcgtgattgccgccattgccgaaagcacaggcgctttgcttgcggggggtgatgtg
gtttcgaccatctccaaggggatcatcgatccggcctcggtgcaaaacagcgaggtgttc
atctgggccatgatggcggcgctgatatcgtcagccatgtgggtcaacctggcaacctgg
atcggcgctcctgtttccaccacgcattctgtcgtgggcggggtcatgggtgcaggtatt
gccgcagcgggcctgagcgcggtgagctggggcacaatgagcgcaattgcggccagctgg
gtgatctcgccggtgcttgggggtgtgattgcagcgggttttctggcgctgatcaggtca
aagatccagcatcaggacgacaagattgcagccgcgcgcaaatgggtgccaatccttttg
gcggtgatggctggggccttttccacatatatgtccgtcaaagggctgaagcggatcgtg
acaatcgatctggagatggctttgctgatcgggttgtctgtggggcttctggcctggtcc
gtgaccgtcccgtgggtcaaacgcaaatcagaaggaatggagaaccggacccggtctctg
aaaacgctgtttgggctgccccttgtgatctcggccacgttcctgagtttcgcccacggc
gcaaatgacgtggccaatgcggtcggcccgctggccgcgattgttcacgcggctgaattc
ggagagttcgcagccaaggtttcaatccctctgtgggtgatgatcattggcgcgttcggg
atttcgttcggtctgttcctgttcggccccaggctgatccgcatggtgggcagtcagatc
accaagctgaacccgatacgcgccttttgcgtcgccctgtcggcggcgatcaccgtaatt
ctggccagctggctgggtctgccggtcagttcgacccatattgccgttggagcagtcttt
ggcgtcggcttctatcgcgagtggcattccgagcgtcggcgcaagcagggaaaccttcag
cgcacggcgcaacaccttgccccggaagaataccgccgtcgcaagctggtgcgccggtcg
catttcatgaccatcgtggcggcatgggttgtgaccgtgccagccgctgcaaccatgtcg
gccgtaatatactgggtactgactgcattcgtctga

DBGET integrated database retrieval system