KEGG   Ruegeria sp. AD91A: D1823_15230Help
Entry
D1823_15230       CDS       T05627                                 

Definition
(GenBank) response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
rua  Ruegeria sp. AD91A
Pathway
rua02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    D1823_15230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rua02022]
    D1823_15230
Two-component system [BR:rua02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   D1823_15230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AXT27794
UniProt: A0A346SK81
Position
3038966..3039667
Genome map
AA seq 233 aa AA seqDB search
MSDMDAHLLIVDDDERIRDLLKKFLMRNGFLVTAARDAAHARRVLSGLDFDMIVMDVMMP
GEDGVSLTRALRETHTTPILLLTAKGETEHRIAGLEAGADDYLAKPFEPKELLLRINAIL
RRMPETPAEETTAKILNLGPFRYDIERGEMWQGEDPVRLTATESQLMKIFSAQPGEPISR
AKLVEDLGRDKGQAQERAVDVQITRLRRKIEQDPKQPRYLQTVRGAGYMLAPD
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatatggatgcccatctgctgattgtcgacgatgacgagcgcattcgcgatctg
ctcaagaagtttctgatgcgaaacgggtttctggttacagcggcacgggatgcggcccac
gcgcggcgcgtattgtcggggttggatttcgacatgatcgtcatggacgtgatgatgccg
ggcgaggatggtgtcagtctgacccgtgctttgcgggaaacgcatacgacaccgatcctg
ctgctgaccgcaaagggtgagacggaacatcggatcgcgggccttgaggccggggcggat
gattacctggcaaaaccgttcgagccgaaagaactgctgttgcggatcaacgcgatcctg
cgccggatgccggaaacgccggcagaagaaaccacggcgaagatcctgaacctcgggccc
ttccgctatgacattgaacgcggtgagatgtggcagggcgaagacccggtccgtctgacc
gcaaccgaaagccagttgatgaagatattctcggcccagcccggagagccgatcagccgt
gccaagctggtcgaggatctgggtcgcgacaagggccaggcgcaggagcgcgcggtggat
gtgcagatcacgcgccttcgacgcaaaatcgaacaggaccccaagcagccacgctatttg
cagactgtgcggggcgcagggtatatgcttgcgccggattga

DBGET integrated database retrieval system