KEGG   Ruegeria sp. AD91A: D1823_17850Help
Entry
D1823_17850       CDS       T05627                                 

Definition
(GenBank) SDR family oxidoreductase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
rua  Ruegeria sp. AD91A
Pathway
rua00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:rua00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    D1823_17850
Enzymes [BR:rua01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     D1823_17850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AXT28260
UniProt: A0A346SLJ7
Position
complement(3542096..3542896)
Genome map
AA seq 266 aa AA seqDB search
MSFSIAGKTAIVTGGANGIGLAIGRHFADAGANVMFADIDEKSLVDEVGEQAEDGNIRYF
AGDLREKLTIANLLSATLDAFDQVDILINGARQVIQSDPLDPDDDSMRTLLNQNLMPALR
LSQLVAKRMIKQSGDDDESPAGSIINLSSIAARRTHPDLMAYSVSTAALDQLTRSLAVAL
APNRIRVNSIALGSVMSASLQSTLKENRDFRDDIEKHTPLARIASATELTETAQYLASDA
AGFITGQILTIDGGRTLLDPVAAPAH
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtccttttccatcgcaggcaagacagcaatcgttacaggcggggccaatggcatcgga
ctggccataggacggcatttcgcagatgcgggcgcaaacgtcatgttcgccgatatagat
gaaaaaagcctggtcgatgaggttggggaacaggcagaggacggcaatattcgctacttc
gcaggcgatctgcgcgaaaagctgaccattgccaatttactgtcggcaacactggatgcg
tttgatcaggtggatattctgatcaacggggcgcgccaagtgatccagtctgatccgctg
gaccctgatgatgactcgatgcgcaccttgctgaaccagaacctgatgcctgccctgcgg
ctcagccaactggtcgcaaagcgtatgatcaaacagtccggggatgacgatgaaagcccg
gcaggatcgatcatcaacctgtcttcaatcgcagcccggcgcacgcatccggacctgatg
gcctattccgtgtcgaccgccgcgttggatcagttgacacgttcactggccgtggcgctg
gcgccgaaccgcatccgggtcaattcgattgcgctcggctcggtcatgagcgcatccctg
caatcgacgctgaaagagaaccgagacttccgcgacgatatcgaaaagcacacaccgctt
gcccgcatcgcgtcggccaccgaattgacggaaaccgcgcagtacctggcatcggatgca
gccggattcatcaccggccagatcctgacaatcgacggcggccgcacattgcttgaccct
gttgccgcacccgcgcattaa

DBGET integrated database retrieval system