KEGG   Ruegeria sp. AD91A: D1823_21165Help
Entry
D1823_21165       CDS       T05627                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
rua  Ruegeria sp. AD91A
Pathway
rua00520  Amino sugar and nucleotide sugar metabolism
rua01100  Metabolic pathways
rua01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    D1823_21165 (nagA)
Enzymes [BR:rua01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     D1823_21165 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRNT
Motif
Other DBs
NCBI-ProteinID: AXT29196
UniProt: A0A346SP83
Position
unnamed1:607748..608881
Genome map
AA seq 377 aa AA seqDB search
MTSSTIIFAGGPIFDGTELREGYAARFRNGLLDALVPLDQIAHDDQIEDLHGDILSPGYA
DLQVNGGGGVMFNDDPSVQSLTQIARAHRALGAMSILPTLITDTAEKTRAAIDSAIKAVQ
TGVSGIAGLHLEGPHLSERRKGAHDAAMIRPMRQTDLETLIDAAKHLPALMVTLAPESTT
LQQVEALKRAGVIVSLGHTDAPFETCLAFSRAGAQCATHLFNAMSQLGSREPGLVGAALS
CGSLSAGLIADGIHVHPDTMRIAWAAKRGPGRIFLVSDAMAVAGTSLAEFQLEGRPIRRE
NGRLTLEDGTLAGADLCLTTAVQVLTDQAEIPFQEALAAATSVPLAMISGKSTGLKPALS
QMILISPDLSRARPVQP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaccagttctaccatcatctttgcgggcggcccgatcttcgatggcactgaattgcgt
gaaggatacgccgcacggttcagaaacgggctgttggatgcgttggtccccttggatcag
atagcgcatgacgaccagatcgaggatctgcatggcgacatcctcagccctggctatgct
gatctgcaggtgaacggcggtggtggcgtgatgttcaacgacgatccatcggttcagtca
ctgacccaaatcgcccgtgctcatcgcgcgctgggtgcgatgagcatcctgcccaccctg
atcactgacacggccgagaaaacccgagccgctattgattccgccatcaaggccgttcag
acgggtgtttccggtattgcgggcctgcatctggaaggtcctcacctgtctgagcggcgc
aagggcgcacatgatgcagcgatgatccgcccgatgcggcaaaccgacctggaaactttg
atcgatgctgcaaaacacctgcctgcgttgatggtgacgctggcgcccgaaagtacaaca
ctgcagcaagttgaagcattgaagcgtgcgggggtgatcgtctctttgggccacacggac
gcgccttttgagacctgcctggcgttctcaagggccggggcgcagtgcgcaacgcatctg
ttcaatgcgatgagccagcttggcagccgagaacccggactggttggcgcggcgttatcc
tgcggatcgctatcggcgggcttgatcgcggatggtatccacgttcatcccgacacaatg
cggattgcctgggccgccaagcgcggacctgggcggatttttcttgtcagcgatgcgatg
gcggtcgctggcacgtcactggcggagtttcagttggaaggacgccccatccggcgggaa
aacggcaggctgacgttagaggatggcactctggccggggccgatttgtgcctgacaaca
gcggtacaggttctgacggaccaagcggagatcccgtttcaagaagcactcgcagcagca
acaagcgttccgttagcgatgatttccggcaagagtacaggactaaagccagcgctttcg
cagatgatactgatttccccggatttgtcccgggccagacctgtgcaaccctga

DBGET integrated database retrieval system