KEGG   Ruegeria sp. AD91A: D1823_21445Help
Entry
D1823_21445       CDS       T05627                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
rua  Ruegeria sp. AD91A
Pathway
rua00350  Tyrosine metabolism
rua00360  Phenylalanine metabolism
rua00380  Tryptophan metabolism
rua01100  Metabolic pathways
rua01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rua00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    D1823_21445
   00360 Phenylalanine metabolism
    D1823_21445
   00380 Tryptophan metabolism
    D1823_21445
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rua04147]
    D1823_21445
Enzymes [BR:rua01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     D1823_21445
    4.1.1.105  L-tryptophan decarboxylase
     D1823_21445
Exosome [BR:rua04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D1823_21445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AXT29247
UniProt: A0A346SPD4
Position
unnamed1:complement(678548..679945)
Genome map
AA seq 465 aa AA seqDB search
MNWDTFSYWGQHISKWAADYHKTLAERPVRAQTAPGEIAAQLVPVPPETGEPMDAILADF
ERIVMPGITHWQHPRFFAYFPANAAPPSMLAEMLVTTIAAQCMLWQTSPAATEVEGVMVE
WLRQALGLPEGMTGVIQDSASSATLSAVLTMRERATGFTGNREGLNAKGALRIYCSDQVH
SSIDRACWVAGIGQDNLVKLPTQGPNFGIVPSALEAAVQNDIAAGHIPAGIVAITGGTGV
GACDDLMAVADIAKKYDLYTHLDAAWAGSAMICPEFRKALWQGAGRYDSIVFNPHKWMGA
QFDCAIQFLRDAAPQLNTLKIEPEYLKTTGAEVTNYSEWTIPLGRRFRALKIWFLLRSYG
LEGLRERIRNHVTWASELAEKIGSIEGFEITTGPILSLFSFRCPGDDAQQQRLVDALNDD
GRIYLTQGLFDGRKIIRFQVGQFDTTRDDVLMAADVIRDVWETIE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggacacgttttcgtattggggtcagcacatctcgaaatgggcggcggattat
cacaagacacttgctgaacgtcccgtgcgggcgcagaccgcgccgggggaaatcgcggcc
cagcttgtgccagtaccacccgagacaggcgagccgatggacgccatcctggccgatttc
gaacggatcgtgatgccgggcatcacccattggcagcatccacgcttctttgcgtatttc
ccggccaatgccgcgcccccgtccatgttggccgagatgctggtgacgactatcgcagcg
caatgcatgttgtggcagacatcgcctgccgcgaccgaggttgaaggcgtcatggtcgaa
tggttgcggcaggcccttggattgcctgagggcatgaccggcgtcattcaggacagcgcc
tcttcggctacgttatcagcagtgctgaccatgcgggaacgggccaccggctttaccggc
aaccgagaaggtctgaacgcgaagggtgcattgcggatttattgttcggatcaggtgcat
tcgtcgattgaccgggcctgctgggtcgctgggattggtcaggacaatctggtcaaattg
cccacacaggggccgaacttcgggattgttccctcggcgcttgaggccgccgttcagaat
gacattgccgccgggcatattccggccgggatcgttgccattaccggcggcacaggagtg
ggggcttgcgacgaccttatggccgtagctgacattgcgaaaaaatacgacctctacacc
catctcgacgccgcttgggcgggatcggccatgatctgcccggaatttcgcaaggctttg
tggcagggggccggtcgctatgacagcattgtcttcaacccgcataaatggatgggcgcg
caattcgattgtgccatccagttcctgcgagacgccgcgccccagctcaatacgctgaaa
attgaaccggaatacctcaagacaaccggtgcagaggtgacaaattactctgagtggacc
atccctttgggccgcaggttccgggcgttgaaaatctggttcctgttgcggtcatacggg
ttggaaggattgcgcgaacgcatccgcaaccacgtgacatgggccagcgaactggcggaa
aagatcggttcgatcgaggggttcgagataacaaccggcccgatcctcagcttgttttcc
ttccgctgtcccggggacgacgcccagcaacagcgtctggtggacgcgctgaatgacgat
ggccggatttacctgacccaaggcttgttcgatggccgcaaaatcatccgctttcaggtc
gggcagttcgataccacccgcgatgacgtgctgatggcggcggacgtgatccgggacgtg
tgggagactattgaatga

DBGET integrated database retrieval system