KEGG   Rufibacter sp. DG15C: TH61_05925Help
Entry
TH61_05925        CDS       T04326                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
rud  Rufibacter sp. DG15C
Pathway
rud00790  Folate biosynthesis
rud01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rud00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TH61_05925
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rud04147]
    TH61_05925
Enzymes [BR:rud01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     TH61_05925
Exosome [BR:rud04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TH61_05925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a DUF417
Motif
Other DBs
NCBI-ProteinID: AMM50809
UniProt: A0A127B1M1
Position
1409573..1409818
Genome map
AA seq 81 aa AA seqDB search
MWKEEDNSLKKSFTFKDFKEAFVFMSEVAEAAEHLNHHPWWSNVYNKVNIELTTHDAGNT
VTEKDWELAKQIDEIAKTLGQ
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaagaagaagacaatagcttgaaaaagagcttcacgttcaaggatttcaaagag
gccttcgtgtttatgagtgaagtagcagaggccgccgaacacctcaaccaccacccctgg
tggagcaacgtctacaataaagtgaacattgaactgaccacccatgacgccggcaacact
gtcaccgaaaaagactgggaactggccaagcagattgacgagatagccaagaccttaggg
caataa

DBGET integrated database retrieval system