KEGG   Ruegeria sp. NKC1-1: DT065_02645Help
Entry
DT065_02645       CDS       T05571                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
rue  Ruegeria sp. NKC1-1
Pathway
rue00270  Cysteine and methionine metabolism
rue00920  Sulfur metabolism
rue01100  Metabolic pathways
rue01110  Biosynthesis of secondary metabolites
rue01130  Biosynthesis of antibiotics
rue01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rue00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    DT065_02645
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DT065_02645
Enzymes [BR:rue01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     DT065_02645
    2.3.1.46  homoserine O-succinyltransferase
     DT065_02645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS GATase HupH_C
Motif
Other DBs
NCBI-ProteinID: AXF57834
UniProt: A0A345C3Q3
Position
complement(487175..488083)
Genome map
AA seq 302 aa AA seqDB search
MPIKIPNELPAKDILQQENIFVMNERRAYTQDIRPLHIVILNLMPLKETTETQLLRLLGN
SPLQVDITFLHPSTHRSKNTSPEHLEAFYKSFADVKDQYFDGMIITGAPVERLSFEDVDY
WDELVEMLEWSKTNVTSTLHICWGAQAALYYHFQIPKCELPRKQFGVYKHEIKVKNSPLL
RGFDDQFYVPHSRYTTTKNEDIEAEEELVILADSDDAGVYLISDFNGSQVFVTGHAEYDA
TTLRDEYNRDRERGLDTQAPTGYFPSENPDNDPLLIWRAHSHLLFSNWLNYYVYQETPYE
LR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgccaataaaaattccgaacgaattaccggcaaaagatatactgcagcaagagaatata
ttcgtaatgaatgaaaggcgggcgtatacgcaagacatccgtccgttgcatatcgttata
ttgaatttaatgccattgaaagaaacgacggaaacccaacttttacgattgttgggaaat
tctcctctgcaagtggatattacgttcttacatccgagcacacaccgatcaaaaaatacc
tcccctgaacatttggaagctttttataaaagttttgcggatgtcaaggatcaatatttt
gatggcatgatcatcaccggtgcaccggttgaacgattatccttcgaggacgttgactat
tgggacgaattggttgaaatgttggagtggagtaaaaccaacgtcacttccaccttgcat
atttgttggggagcacaggcagccttatattatcatttccaaattccgaagtgtgagctg
ccccgcaaacaattcggagtttacaaacatgagattaaagtgaagaacagtccgcttttg
cgtgggtttgacgatcaattttatgttccccattcccgatatacgacgacgaaaaatgag
gatattgaagcagaagaagagctggttatactggctgattcggacgacgccggtgtgtac
ttgatctcagattttaacggaagtcaggtgtttgtcaccggacacgcggaatatgatgca
acaactttaagagacgagtacaaccgcgaccgagaacgaggactcgatacacaagcgccg
accggttattttccgagcgagaatccggacaatgatcctttactcatttggagagcccat
tcccatctgcttttttccaattggctaaactattacgtctaccaagaaacaccttatgag
ttacgttga

DBGET integrated database retrieval system