KEGG   Rufibacter sp. DG31D: TH63_03770Help
Entry
TH63_03770        CDS       T03996                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ruf  Rufibacter sp. DG31D
Pathway
ruf00480  Glutathione metabolism
ruf00590  Arachidonic acid metabolism
ruf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ruf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    TH63_03770
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TH63_03770
Enzymes [BR:ruf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TH63_03770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: AKQ44944
UniProt: A0A0H4VMG2
Position
876636..877223
Genome map
AA seq 195 aa AA seqDB search
MDLKKRILKMLYPLIMRLSKASAKGRVLTNEKKVAPAQPFYNLNTVLNNGKPLEFSQLKG
KKVLLVNTASNCGYTGQYEELQQLHEQKKDSLVIIGFPANDFKEQEKDNDADISQFCQVN
YGVTFPLAKKSVVVKNENQNQVYNWLSDARKNGWNEHEPDWNFSKYLLDENGVLTHYFGP
AVSPLSPEVQEALKQ
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggatcttaagaaacgaatactcaaaatgctctaccccctgatcatgcgcctgtctaag
gccagcgcgaagggaagggtattgactaacgagaagaaggtggcgcctgcccaaccgttc
tataacctgaacaccgtgctcaacaacggcaagcccctggagtttagccaactgaaaggc
aagaaagtgctgctggtgaacacggcctccaactgcggctacaccggccaatatgaagaa
ctgcaacagctgcatgagcagaagaaagactcgctggtgatcatcgggtttccggccaat
gactttaaggagcaggagaaagataatgacgccgatatctctcagttctgccaggtgaat
tacggggtcacgtttccgttggccaaaaagagcgtggtggtgaaaaacgaaaaccagaac
caggtctacaactggctctcagatgcccgaaagaacggctggaacgagcatgaacccgac
tggaacttcagtaagtacctgctggatgagaacggcgtattgacccattatttcgggccg
gccgtttctccgctgagccccgaggtgcaggaagccctgaaacaatag

DBGET integrated database retrieval system