KEGG   Hungateiclostridiaceae bacterium KB18: A4V00_04860Help
Entry
A4V00_04860       CDS       T04437                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ruk  Hungateiclostridiaceae bacterium KB18
Pathway
ruk00450  Selenocompound metabolism
ruk00970  Aminoacyl-tRNA biosynthesis
ruk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ruk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A4V00_04860
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A4V00_04860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ruk01007]
    A4V00_04860
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ruk03016]
    A4V00_04860
Enzymes [BR:ruk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     A4V00_04860
Amino acid related enzymes [BR:ruk01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   A4V00_04860
Transfer RNA biogenesis [BR:ruk03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A4V00_04860
 Prokaryotic type
   Other AARSs
    A4V00_04860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 DUF1272 tRNA-synt_1b
Motif
Other DBs
NCBI-ProteinID: ANU53419
UniProt: A0A1C7GMG7
Position
975566..977542
Genome map
AA seq 658 aa AA seqDB search
MESKGAYYITTAIAYTSGKPHIGNVADPVLADCIARFKRMQGYDVYFQTGTDEHGKKNEQ
KAKAANLSPKEFVDGTSALVKEQFDLMNLSYDHFIRTTDDYHVKEVQKIFKKFYDQGDIY
KSSYEGLYCDECESFLTESQLIDGKCPDCGREPRKEQEEAYFFKMSNYTQRLIDHINSHP
DFIQPVSRRNEMMNNFLLPGLQDLCVTRTSIKWGIPVDFDPKHVIYVWLDALTNYITGLG
YHCGGESGELFKKYWPAGLHVIGKDITRFHTIYWPIFLMALDLPLPKQVFGHPWVLMDGS
KMSKSAGNVMYADDLVDIFDADAVRYYILKELPFENDGNITWDLINERTNSDLANILGNL
VNRTVSMINKYFGGKVEDCKIAAPEDEDLHACVSACRDKVADKMERLRTADALTEIFALF
KRCNKYIDETTPWILAKDPQKGPRLSTVLYNLVDSIATGATLLFPFMPETSVAILRQLGT
VPLPWELLDKTNNYPANGGKVTDTPSILFERQEMEDIIKRMEEKYANSEPAPAEDDMQKK
AELHKELQGIAKIGIEDFAAVDLRVAKIIDCQPVKRAKKLLKLSLDDGTGVVRTVASGIA
PWYKPEDLTGRHIIVVSNLKPATLCGVESQGMILAADSGENEVKVIFADNIPAGSKVR
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaaaaggcgcttactatatcaccacagctatagcctatacctcaggcaagcca
catatcggcaacgtggccgaccctgttttagccgactgcatcgcccgcttcaagcgtatg
cagggctatgacgtgtacttccagaccggcaccgacgagcacggcaaaaagaacgagcaa
aaggccaaggccgcgaatctctcccccaaggagttcgtggacggcacctccgctctggta
aaagagcagttcgacctgatgaacctcagctacgaccactttatccgcaccaccgacgac
taccacgtaaaagaggttcagaagatattcaaaaagttctacgaccagggggacatctac
aagagctcctatgagggcctctattgtgacgagtgcgagtccttcctcaccgagagccag
ctcatagacggcaagtgccccgactgcggccgggagccccgaaaggagcaggaggaggcc
tacttcttcaagatgagcaactacacccagcggctcatcgaccatataaattcccacccc
gactttatccagccggtctcccgccgcaacgagatgatgaacaacttcctgctgcccggg
ctccaggacctgtgcgtgacccgcacctccataaagtggggcatccctgtggacttcgac
cccaagcacgtcatctacgtctggctggatgcgctgaccaactatatcaccggccttggc
taccactgcggcggcgagagcggcgagctctttaaaaaatactggcccgccggcctgcac
gttatcggcaaggacatcacccgcttccacaccatctactggcccatcttcctgatggct
ctggacctgcctttgccaaaacaggttttcggccacccctgggtcctgatggacggcagc
aagatgagcaaatccgccggcaacgtgatgtacgccgacgacctggtggatatcttcgac
gccgacgcggtgcgttactatatcctaaaggagctgccctttgagaacgacggcaacatc
acctgggacctgataaacgagcgcaccaacagcgaccttgccaatatcctgggcaatctt
gtgaaccgcacggtgtccatgataaacaaatacttcggcggcaaggtggaggactgcaaa
atagccgcccccgaggacgaggacctacacgcctgcgtctcggcctgccgggacaaggta
gccgataagatggagcgcctgcgcaccgccgacgccctcacagagatatttgcccttttc
aagcgctgcaacaagtatatcgacgagactaccccctggatactggcaaaggacccccaa
aagggcccgcgcctgtccacggtgctctataaccttgtggactccatcgccaccggcgcg
accttactgttcccctttatgcccgagacctcggtcgctatcctgcggcagctgggcacc
gtccctctgccctgggagcttctcgataagaccaacaactacccggcaaacggcggtaag
gtcaccgataccccctctatccttttcgagcgtcaggagatggaggacatcataaagcgc
atggaggagaagtacgccaacagcgagcccgcccccgccgaagacgatatgcagaaaaag
gcagagctccacaaggagctccagggcatagcgaagataggcatagaggattttgccgcc
gtggacctgcgagtggcgaagataatcgactgccagcccgtaaagcgcgctaaaaagctc
ttgaagctcagcctggacgacggcaccggcgtggtgcgcacggtggcctcgggcatcgcc
ccctggtataagcccgaagacctcaccggccgtcatattatagtcgtctccaacctgaag
cccgccaccctctgcggcgtggagagccagggcatgatactggccgccgattcaggagaa
aatgaagtaaaagtgatattcgccgacaatatccctgccggcagcaaggtccgctga

DBGET integrated database retrieval system