KEGG   Ruminococcus sp. SR1/5: CK1_21490Help
Entry
CK1_21490         CDS       T02601                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
rum  Ruminococcus sp. SR1/5
Pathway
rum00010  Glycolysis / Gluconeogenesis
rum00020  Citrate cycle (TCA cycle)
rum00620  Pyruvate metabolism
rum01100  Metabolic pathways
rum01110  Biosynthesis of secondary metabolites
rum01120  Microbial metabolism in diverse environments
rum01130  Biosynthesis of antibiotics
rum01200  Carbon metabolism
Module
rum_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CK1_21490
   00020 Citrate cycle (TCA cycle)
    CK1_21490
   00620 Pyruvate metabolism
    CK1_21490
Enzymes [BR:rum01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     CK1_21490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 FrhB_FdhB_C
Motif
Other DBs
NCBI-ProteinID: CBL20158
UniProt: D4LJZ7
Position
complement(1847297..1848901)
Genome map
AA seq 534 aa AA seqDB search
MAKIDLTKYGITGTTEIVYNPSYETLFEEETKPELEGFEKGQVSELGAVNVMTGIYTGRS
PKDKYIVMDENSKDTVWWTSDEYKNDNHPATQEAWNAVKDLAKKELSNKKLFVVDAFCGA
NKDTRMAIRFIVEVAWQAHFVTNMFIQPTAEELENFEPDFVVYNASKAKVENYKELGLNS
ETAVMFNITSREQVIVNTWYGGEMKKGMFSMMNYYLPLKGIASMHCSANTDLNGENTAIF
FGLSGTGKTTLSTDPKRLLIGDDEHGWDDNGVFNFEGGCYAKVINLDKESEPDIYNAIKR
NALLENVTLDAEGKIDFADKSVTENTRVSYPINHIENIVRPVSSAPAAKEVIFLSADAFG
VLPPVSILTPEQTQYYFLSGFTAKLAGTERGITEPTPTFSACFGQAFLELHPTKYAEELV
KRMEKSGAKAYLVNTGWNGTGKRISIKDTRGIIDAILDGSILKAPTKKIPFFNFEVPTEL
PGVDPAILDPRDTYADAAEWETKAKDLAARFVKNFAKYEGNAAGKALVAAGPQA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatcgatttaacaaagtatggtattaccggaacaactgagatcgtgtacaat
ccttcctacgagacattatttgaggaagagaccaaaccggagcttgaaggatttgagaag
ggtcaggtcagtgagcttggtgctgtcaatgtaatgacaggtatctacacaggacgttcc
cctaaagacaaatacatcgttatggatgagaactccaaggacacagtttggtggacatcc
gatgagtacaagaacgataaccatccggcaactcaggaagcatggaatgcagttaaagat
cttgccaagaaggagctttccaacaagaaacttttcgtagtagatgcattctgcggagct
aacaaagacacacgtatggctatccgtttcatcgttgaggttgcatggcaggcacacttc
gtaacaaacatgttcattcagccgacagctgaggagcttgagaactttgagccggatttc
gttgtttacaacgcatccaaggctaaagttgagaactacaaagaattaggacttaactct
gagacagctgtaatgttcaacattacaagccgtgagcaggttatcgttaatacatggtac
ggcggagagatgaagaaaggtatgttctccatgatgaactactatctgccgcttaagggc
atcgcttccatgcactgctctgcaaacacagaccttaacggagagaacacagctatcttc
ttcggtctttccggaacaggtaagacaacactttccacagatcctaagcgtcttctgatc
ggtgatgacgagcatggctgggatgacaacggagtattcaacttcgagggtggatgctac
gctaaggttatcaaccttgacaaagagtctgagccggacatctacaatgcgatcaagaga
aacgctcttcttgagaacgtaacacttgatgctgagggcaagatcgacttcgctgacaag
agcgtaacagagaatacacgtgtttcttacccgatcaaccacatcgagaacattgttcgc
cctgtatcttctgcaccggcagcgaaagaggttatcttcctgtccgcagatgcattcggc
gtacttcctccagtatctatcctgacaccggagcagacacagtactacttcctttccgga
ttcacagctaaacttgctggtacagagcgtggaatcacagagcctactcctacattctcc
gcatgcttcggacaggcattccttgagcttcatccgacaaaatatgctgaggagctcgtt
aagagaatggagaagagcggtgcgaaagcatacctcgttaacacaggatggaatggaact
ggaaaacgtatctccatcaaagatactcgtggtatcatcgatgctatccttgacggatct
atccttaaagctccgacaaagaagatcccattcttcaacttcgaggttccgacagagctt
ccgggcgtagatcctgcaatccttgacccacgtgacacatatgcagatgctgcagagtgg
gagacaaaggctaaagatcttgctgcaagattcgttaagaactttgctaaatatgaagga
aatgcagctggtaaagcactcgttgcagccggcccgcaggcataa

DBGET integrated database retrieval system