KEGG   Ruminococcus sp. SR1/5: CK1_26080Help
Entry
CK1_26080         CDS       T02601                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rum  Ruminococcus sp. SR1/5
Pathway
rum00450  Selenocompound metabolism
rum00970  Aminoacyl-tRNA biosynthesis
rum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CK1_26080
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CK1_26080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rum01007]
    CK1_26080
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rum03016]
    CK1_26080
Enzymes [BR:rum01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CK1_26080
Amino acid related enzymes [BR:rum01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CK1_26080
Transfer RNA biogenesis [BR:rum03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CK1_26080
 Prokaryotic type
   Other AARSs
    CK1_26080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1f tRNA-synt_1e Anticodon_1 DUF3501
Motif
Other DBs
NCBI-ProteinID: CBL20535
UniProt: D4LL24
Position
complement(2288677..2290656)
Genome map
AA seq 659 aa AA seqDB search
MEKQRYYISTAIAYTSGKPHIGNTYEVVLADAIARFKRQQGYDVYFQTGTDEHGQKIELK
AEEAGVTPKEFVDNVSGEIKRIWDLMNTSYDKFIRTTDKDHEEQVKKIFKKMYAKGDIYK
GHYEGMYCTPCESFFTESQLVDGKCPDCGRPCVPAKEEAYFFKMSKYADKLIDYINTHPD
FIQPESRKNEMMNNFLLPGLQDLCVSRTSFKWGIPVDFDPKHVVYVWLDALTNYITGIGY
DCDGNSSDKFNKYWPADLHLIGKDIIRFHTIYWPIFLMSLDLPLPKQVFGHPWLLQGDGK
MSKSKGNVIYADELVEFFGVDAVRYFVLHEMPFENDGVITWELMVERLNSDLANTLGNLV
NRTISMSNKYFNGVVENKNVIEPVDEDLKSFILQVPKNVSAKMDKLRVADAITEVFSLFK
RCNKYIDETMPWALAKDETKQDRLATVLYNLVEGICIGASLLKSFMPRTTERILVQLNAN
ERTLEEMEQFGLYPSGNRVTDKPEILFARLDLKEVLEKVEKLHPKKEEPKEEPKEEVEEE
KTENVIDIEAKPEITFDDFEKLQFQVGEIIACEEVKKSRKLLCSQVKIGSQVRQIVSGIK
AHYSAEEMVGKKVMVVTNLKPAKLAGILSEGMILCAEDADGNLSLMVPEKEMPAGAEIC
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcagagatattatatcagcactgccattgcgtacacatccggtaaaccgcat
atcggaaatacctatgaggtcgttcttgcggatgcgatcgcacgttttaaaagacagcag
ggttatgacgtatattttcagacaggtactgatgagcatggccagaagatcgagctgaag
gctgaggaggctggtgttacaccaaaggaattcgtagataacgtttccggtgagatcaaa
cgcatctgggatctgatgaacacatcctatgataaattcatccgtacaacagataaagac
catgaagagcaggtcaaaaaaatcttcaaaaaaatgtatgcaaagggagatatctacaag
ggtcattatgaaggaatgtactgtacaccatgtgagtccttcttcacagagtcccagctt
gtagacggcaaatgtccggattgcggacgtccatgcgtacctgccaaggaagaggcatat
ttcttcaaaatgagtaaatatgcagataagcttattgactacatcaacacacatccggat
ttcatccagccggagtcccgtaaaaacgagatgatgaacaacttccttcttccgggactt
caggatctctgtgtatccagaacatcctttaaatggggaatcccggtagatttcgatccg
aagcacgttgtatatgtatggctggatgccctgacaaactatatcacaggtatcggctat
gactgcgacggaaacagcagcgataaattcaacaaatactggccggcagatcttcacctg
atcggaaaagatatcatccgtttccataccatttactggccgatcttcctgatgtctctg
gatcttccgcttccgaaacaggtattcggacatccatggctgcttcagggcgatggaaaa
atgagtaaatccaaaggaaatgtaatctatgcagatgagctggttgagttcttcggtgta
gatgctgtccgttattttgtactccacgaaatgccatttgagaatgacggtgtgatcaca
tgggagctgatggttgagagactgaattccgaccttgcaaacacacttggaaatcttgta
aaccgtacaatttccatgtccaacaaatattttaacggagtcgttgagaataagaatgtt
attgagccggttgatgaggatcttaagagcttcatccttcaggttccgaagaacgtttcc
gcaaaaatggacaagcttcgtgtggcagatgctatcacagaggtattctctctgtttaaa
cgctgcaacaaatatatcgacgagacaatgccatgggcacttgcaaaggatgagacaaag
caggatcgtcttgcaaccgttctctacaacctggttgagggaatctgcatcggcgcatct
cttctgaaatcctttatgccgcgtacaacagagcgtattcttgtacagctcaacgcaaac
gagagaactcttgaggagatggagcagtttggtctttatccttcaggaaaccgcgtaacc
gacaaaccggagatcctttttgcgagacttgacctgaaagaggttcttgagaaggttgag
aagcttcatccgaagaaagaagagccgaaagaagagccgaaggaagaggtagaagaggag
aaaacagagaatgtgatcgatatcgaggcaaagccggagatcactttcgatgattttgag
aagctgcagttccaggttggtgagatcatcgcctgtgaggaggttaagaaatccagaaaa
cttctctgctctcaggttaagatcggaagtcaggttcgtcagatcgtatccggaatcaag
gctcattattccgcagaggaaatggtgggcaaaaaggttatggtcgttacaaacctgaag
cctgctaagcttgccggaatcctcagcgagggtatgatcctctgtgcagaggatgcagac
ggaaatctttccctgatggtaccggagaaagagatgcctgcaggcgctgagatctgctaa

DBGET integrated database retrieval system