KEGG   Runella sp. HYN0085: DR864_10615Help
Entry
DR864_10615       CDS       T05537                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
run  Runella sp. HYN0085
Pathway
run00020  Citrate cycle (TCA cycle)
run00310  Lysine degradation
run00380  Tryptophan metabolism
run01100  Metabolic pathways
run01110  Biosynthesis of secondary metabolites
run01120  Microbial metabolism in diverse environments
run01130  Biosynthesis of antibiotics
run01200  Carbon metabolism
Module
run_M00009  Citrate cycle (TCA cycle, Krebs cycle)
run_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:run00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DR864_10615
  09105 Amino acid metabolism
   00310 Lysine degradation
    DR864_10615
   00380 Tryptophan metabolism
    DR864_10615
Enzymes [BR:run01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DR864_10615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AXE18159
UniProt: A0A344THN8
Position
complement(2492249..2493823)
Genome map
AA seq 524 aa AA seqDB search
MSQIEIKVPTVGESITEVTIGSWVKKDGDSVKRDEVICSLDSDKASFDVVSEADGVLRVK
AQEGDVLPIGGLICVIETSVEVASAPASAPAPVTSTPAPVAVASVAPATAAKVVEMKVPT
VGESVTEVTIASWNKKDGDTVQLDEVLCELESDKATFELPAEAAGVLRIVAEAGSTLSIG
AVICKIEVGAGSAAAPAPVAEAPQSNGQVVSANASNDSYAAGHPSPAAAKILAEKGIDPA
SVAGSGVGGRLTKEDAIAAQPKAAPTATPVEQPKAPVAPPVAPAPAPKAADARGQRRVKM
TSLRKTIARRLVAVKNETAMLTTFNEVDMKPIMDLRAKYKDKFKEKHGVGLGFMSFFTRA
CAVALQEFPVVNAFIDGDEVVYNDFSDISIAVSTERGLVVPVVRNAEKMTFSQIEKEIIR
LAGLARDNKLTIDQMQGGTFTITNGGIFGSMLSTPIINAPQAAILGMHNIVERAVVVNGE
IVIRPIMYVALSYDHRTIDGRDSVSFLVRVKQLLEDPTRLLLEV
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagattgaaataaaagtcccgaccgtcggagaatctatcaccgaagtaaccatt
ggttcttgggtgaaaaaagacggtgatagtgtcaaacgtgatgaagtaatatgcagttta
gactcagataaagcatcctttgatgtcgtttctgaggctgacggtgttttacgagttaaa
gcacaagaaggtgatgtattaccgattggtggactgatatgtgtgattgaaacatcggtg
gaggtagcttccgctccagcgtcagctcccgcgcctgttacttctacgcctgctcccgtt
gctgtggcttcagttgctcctgcaacagcggctaaagtagtggaaatgaaagtgccaacg
gtgggggaatccgtcacggaagtaaccatcgccagttggaataaaaaagacggtgatacc
gttcaattagatgaagtactttgtgaactagagtctgacaaagcaacgtttgaacttcct
gccgaagctgcaggagtgctacgcattgtagccgaagcgggttcgacgttatcaattgga
gccgttatctgtaaaattgaagtcggtgctggaagcgctgctgctcctgctcccgtggct
gaggcgccgcaatcaaacggacaggtggtttcggcaaatgcttccaatgatagttatgca
gcagggcatccctctcccgccgcggccaagattttggccgaaaaaggcattgaccctgca
agtgtagcgggctcaggtgttggcggaagattaacgaaagaagatgccatcgccgcacaa
cctaaagccgctcccacggcaactccagttgagcagcctaaagcgccagtagcgccacca
gtggctccagcccctgctcccaaagcagcggatgctcgtggccaacgccgcgtaaaaatg
acgtcgttgcgcaaaactattgcgcgccgtttggttgcggttaaaaatgaaacggccatg
ttgacaaccttcaatgaggtagacatgaagcctatcatggatttacgggctaagtacaaa
gataaatttaaggaaaaacacggcgtaggcttaggctttatgtcattctttacccgggct
tgcgcggtagctttgcaggaatttccggtagtaaatgcgttcattgacggcgatgaagtc
gtttacaatgatttctcggatatatcgattgcggtttcgaccgagcgtggtttggtggtt
cccgtggttcgtaatgctgaaaaaatgaccttctctcaaattgagaaggaaatcattcgt
ttggctggcctcgcccgcgacaataagctgaccattgaccaaatgcaaggtggcaccttt
accatcaccaacggtggtatttttggttcgatgctctcaacacccatcatcaatgctcca
caggctgcgattttgggaatgcataacatcgttgagcgagctgtcgtggtgaatggagaa
atcgttatacgccctatcatgtacgtagcgctcagttacgaccaccgcaccatcgacggc
cgtgattcggtaagcttcctcgtcagagtgaagcaattgctcgaagaccctacacggtta
ctgttggaagtgtaa

DBGET integrated database retrieval system