KEGG   Runella sp. SP2: DTQ70_02115Help
Entry
DTQ70_02115       CDS       T05690                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
rup  Runella sp. SP2
Brite
KEGG Orthology (KO) [BR:rup00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DTQ70_02115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AYQ31044
UniProt: A0A3G3GK91
Position
complement(539115..539501)
Genome map
AA seq 128 aa AA seqDB search
MTSAITEGVRVSVLTQYQPEYSSPAQAHFVFTYRITIENHSEHTVQLLRRHWHIFDSNGT
IREVEGEGVVGQQPTLEPGEIHEYVSGCNLRTSIGKMVGTYLMERLVDGKQFNVAIPEFT
MIAPYRLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagcgataacagaaggtgtgagagttagcgttttgacgcagtatcagcccgag
tattcgagcccagcgcaagctcattttgtgtttacgtatcgcattaccatcgaaaaccac
agcgagcataccgttcagcttctacgcaggcattggcatatttttgattccaatggtacc
attcgggaagtagaaggggaaggcgtagtgggtcaacaacccacgctcgaacctggcgaa
attcacgaatacgtatcgggctgcaacctacgtactagcattggcaaaatggtggggact
tatctcatggaacgccttgtggatggaaagcagtttaacgttgccattcccgaatttacc
atgattgcgccctatcgtttgaattga

DBGET integrated database retrieval system