KEGG   Runella sp. SP2: DTQ70_13910Help
Entry
DTQ70_13910       CDS       T05690                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
rup  Runella sp. SP2
Pathway
rup00040  Pentose and glucuronate interconversions
rup00053  Ascorbate and aldarate metabolism
rup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DTQ70_13910
   00053 Ascorbate and aldarate metabolism
    DTQ70_13910
Enzymes [BR:rup01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     DTQ70_13910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AYQ33185
UniProt: A0A3G3GP03
Position
3301511..3302986
Genome map
AA seq 491 aa AA seqDB search
MYQDATISEINEAMQRAYAAFLEYRHKSGQEKATFIRAVADEIEALGEAVIEVAMRETHL
PSVRLTGERGRTCNQLRNIADVVAEGSWVDATIDTAIPDRQPLPKPDIRNMLVPIGPVVV
FGASNFPFAYSTAGVDPAAAWGAGCPVVLKAHPAHPETSEMVAGAVRKAIEKTGMPQGLF
EHLQVAGFEVGKALVLHPKTAAVGFTGSYVGGKALFDLANQRPVPIPVFAEMGSTNPVFL
LPDALEKEAAKYAKMYAGSITGGMGQFCTKPGLIIGVESEGLDTFSKTLANEIRQIAPVP
MLHAGIAKAFRSKRSEVIGHEAVTIDAETEGAYQDLDGIPSVASVNGNDFLQNTALHQEV
FGPFSLIIKCKDTAEMNDIIEHLEGQLTCTVIGTDADLANAADLIAAVSLLCGRVLLNGV
PTGVEVCAAMQHGGPFPASTDGRFGSVGAHAIKRFVRPLAYQNFPQHLLPAELKDGNPLG
IWRTVNGNLEK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaagacgccacaatttcagagattaacgaagcgatgcagcgcgcctacgcggct
tttttggaataccgccacaaaagcggccaagaaaaagctacgtttattcgggccgttgcc
gacgaaatagaagccctcggagaggcggtcattgaagtagctatgcgcgaaacgcacctg
ccatcggttcgtcttacgggcgagcgcgggcgtacctgtaaccaacttcggaacattgcc
gatgtggttgcggagggttcgtgggtggacgccaccatcgacacggccattcctgaccgc
cagccactgcccaaacccgacattcgcaatatgctcgttcccatcgggccagttgttgta
tttggagcaagtaattttccttttgcgtactcaacagcgggtgttgaccccgcagcggcc
tggggagcaggttgccccgtagttctaaaagcccaccctgctcaccccgaaacttcggag
atggttgcaggtgcagttcgtaaagcaattgaaaaaacgggtatgccacaggggcttttt
gagcacctacaagtagcaggttttgaagtaggcaaagcgcttgtattgcaccccaaaacg
gcagcagtaggtttcactggctcttacgtgggaggaaaagcgctgttcgacttggcgaac
caacgtcctgtacccattcctgtttttgccgaaatgggcagcaccaaccctgttttcctt
ttgcccgatgcgcttgagaaagaagcggccaagtacgctaaaatgtacgcaggttctatc
acgggaggcatgggacagttttgtaccaaaccaggtttgattattggggtagaaagcgaa
ggactcgatacctttagcaaaacccttgccaacgaaattcgccaaatcgctcctgtacct
atgttacacgcgggaatcgccaaggcattccgcagcaaacgcagtgaagtcattggccac
gaagccgtgacaatagacgctgaaaccgaaggtgcttaccaagatttagacggtattcca
tcggtggcttcggtaaatgggaacgactttttacaaaataccgccctccaccaagaggtc
tttggccctttttcattgattatcaagtgcaaagacacggccgaaatgaacgatattatc
gaacatttggaagggcagcttacttgcaccgtcattggaactgacgccgaccttgccaac
gccgccgacttgattgcggccgtgagccttttgtgcggccgtgttcttcttaatggcgtt
ccgacgggtgttgaagtgtgcgcggcaatgcagcacggtgggccattccccgccagcacc
gacggccgttttggctccgtaggcgcgcacgccatcaagcgttttgtgcgtccattggcg
taccagaattttccacaacaccttctccccgctgagctcaaagatggtaacccgttagga
atctggcgaacggtgaatggaaatttggaaaagtaa

DBGET integrated database retrieval system