KEGG   Runella sp. SP2: DTQ70_24175Help
Entry
DTQ70_24175       CDS       T05690                                 

Definition
(GenBank) glycogen synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
rup  Runella sp. SP2
Pathway
rup00500  Starch and sucrose metabolism
rup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DTQ70_24175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rup01003]
    DTQ70_24175
Enzymes [BR:rup01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     DTQ70_24175
Glycosyltransferases [BR:rup01003]
 Polysaccharide
  Storage polysaccharide
   DTQ70_24175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: AYQ35067
UniProt: A0A3G3GUL6
Position
complement(5995953..5997770)
Genome map
AA seq 605 aa AA seqDB search
MEKKQKKSLLFEIAWEVCNQVGGIYTVIRSKVPAMVDQWGDEYVCLGPYFPQRALTEYEP
ITSDDGSGLYQVVQKMREEGLAVEYGYWLITGKPRVVLFDIRSMMPRLDAIKYGLWERHQ
ISTVNVEDLVNQTLCFGEMVRMFLTYYAQDYARKFDITAHFHEWMASSGLPDLRRDDVRV
ATVFTTHATMLGRYIASNERDFYHKLPYFDWKHEARHYGIEAQATVERLAYLNAHVSTTV
SDVTARECEVFLGKTPDLVLPNGLNIQRFAAVHEFQNLHMKYKENIHDFVMGHFFQSYSF
NLDKTLYFFTSGRYEFVNKGYDITLEALARLNWKMVQAKMDMTVVMFIVTKQPYHSINPD
VLQSRAVLGEIQDTCSAIEKQLGEKLYMASAASSDHNLPDLNQFVDEYWRLRLRRTIQTW
KTKRLPPYVTHDLKTPDSITEFCERSGLKNHEQDRVKIVYHPDFIASTNPLFGLDYGQFV
RGCHLGIFPSYYEPWGYTPLECVVRGIPTVTSDLSGFGDFIMQIMRDYENRGIYVINRNT
QNFDQAADQLANILFKFVKMNLRERIQQRNKVENIAEVFDWNNLRSYYDTAHDLAAKRAH
KTRVS
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaaaacaaaaaaagagtctcctctttgaaatcgcttgggaggtttgcaaccaa
gttggggggatttataccgtgataagaagcaaggtccctgccatggttgaccagtggggc
gacgaatacgtctgtcttggcccttatttcccacaacgcgcactcaccgaatatgaaccc
atcacgtcggacgacggctcaggtctttaccaagttgttcaaaaaatgcgcgaagaaggc
ttggcagtcgagtatggatattggctcattacgggcaaaccgcgcgtggttttgtttgac
attcgtagcatgatgccgcgcctagatgccatcaaatatggcttgtgggaacgccaccaa
atctcgacggtcaatgttgaagacctcgtcaaccaaaccctttgctttggcgaaatggtg
cggatgtttttgacctattacgcccaagattacgctcgtaagtttgatattacggctcat
ttccacgagtggatggcaagttcgggattgcctgatttgcgccgcgacgacgtgcgggta
gcgaccgtatttactacccatgccaccatgctagggcgttatatcgcttccaacgagcgc
gatttttaccacaaactcccttacttcgactggaaacacgaagctcgacactatggcatt
gaagcacaagcgacggttgaacgactcgcgtacttgaatgcccacgtcagcaccacggtc
agcgacgtaaccgctcgcgaatgtgaagtatttcttggaaaaacgcctgacctcgttctc
cccaacggccttaacattcagcgatttgcggctgtccacgagttccaaaaccttcacatg
aaatacaaggagaatatccacgatttcgtgatggggcatttcttccaaagctattccttc
aatcttgataaaacgctctatttcttcacgtcggggcggtatgagtttgtcaacaaaggc
tacgacattacccttgaagccctagcgcgcctcaactggaaaatggtacaagccaaaatg
gacatgacggtggtgatgtttatcgtaaccaaacagccatatcattctattaatcctgat
gtactccaatcacgagccgttctaggggaaattcaggatacgtgtagcgccatcgaaaaa
caattaggcgagaaattgtacatggcttcggccgcatcgagcgaccacaatttacctgat
ttaaaccagtttgtggacgaatactggcgcttgcgtttacgtcgtacgattcagacgtgg
aaaacaaaacgccttccgccgtacgtgacgcacgacttaaaaacgcccgattctatcacc
gaattctgcgagcgttcgggacttaaaaaccacgagcaagaccgcgtgaagattgtatat
caccccgactttattgcatctaccaatcctctctttggtttagattatgggcaatttgtg
cgtggatgtcacttaggtattttcccaagttactacgaaccatggggctatacgccactt
gagtgcgtcgtgcgtggaattccgaccgtgacgagtgatttgtctggttttggggacttt
atcatgcaaatcatgcgcgactatgagaaccgtggtatttatgttatcaatcgtaacaca
cagaacttcgaccaagcagccgaccaacttgccaacattttattcaagtttgtcaaaatg
aacctccgcgaacgcattcaacagcgtaataaagtggaaaacattgccgaagtgttcgat
tggaacaacctccgttcgtactacgacaccgcccacgacttggccgccaaaagagcacat
aaaacaagagttagctag

DBGET integrated database retrieval system