KEGG   Rhodomicrobium vannielii: Rvan_0039Help
Entry
Rvan_0039         CDS       T01353                                 

Definition
(GenBank) benzoyl-CoA reductase, subunit A
  KO
K04114  benzoyl-CoA reductase subunit A [EC:1.3.7.8]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00362  Benzoate degradation
rva01100  Metabolic pathways
rva01120  Microbial metabolism in diverse environments
rva01220  Degradation of aromatic compounds
Module
rva_M00541  Benzoyl-CoA degradation, benzoyl-CoA => 3-hydroxypimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:rva00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rvan_0039
Enzymes [BR:rva01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.8  benzoyl-CoA reductase
     Rvan_0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BcrAD_BadFG FGGY_N DEDD_Tnp_IS110 Hydant_A_N FtsA
Motif
Other DBs
NCBI-ProteinID: ADP69329
UniProt: E3I4X5
Position
44998..46290
Genome map
AA seq 430 aa AA seqDB search
MRCFIGIDLGSTTTKAVVMDENQNVLGRGITNSRSNYDTAAAVSKQEALVDTRLTLFRRA
LEAVPGTADTAEAVLAGLERNFRHIQFVEQLEDLERTCIGNVKGPRFAGREKPVIEALAE
TFRRLREHSATQFAPGFRRKSDFFRDLAGGDFMHNGEAVCREAGLAFDLILNIYDKSIIE
VENRPPAGDIEGKFVRALEMGSLDQSLIAAPVKAALSIPLEETYVVGTGYGRVRLPFPKE
HIRSEILCHGLGAHIMYPRTRTVLDIGGQDTKGIQVDPAGIVENFQMNDRCAAGCGRYLG
YIADEMNMGLQELGPLAMQSTKQVRINSTCTVFAGAELRDRLALGEKREDILAGLHRAII
LRAMSILSRAGGVKDQFTFTGGVAKNEAAVRELRKLIKENYGDVQININPDSIYTGALGG
AAFAVRAVLN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgcttcatcggcatcgacctcggttccaccaccacgaaagccgtggtcatggac
gaaaaccagaatgtgcttgggcgcggcatcaccaactcgcgctccaattacgacaccgcc
gctgcggtctcgaagcaggaggcgctcgtcgatacacggctgacactgttccgccgcgct
ctcgaagccgtgcccggaacggcggacaccgcagaagcagtcctcgccggtcttgagcgg
aatttccgtcacatccagttcgtcgaacagctcgaagatctggagcgcacctgcatcggc
aacgtgaagggtccgcgcttcgccgggcgcgaaaagcccgtcattgaagcgctggcggag
acgttccggcggcttcgcgagcactccgcgacgcagttcgcgccgggcttccgccgcaag
tccgactttttccgcgacctcgcgggcggcgatttcatgcacaacggcgaggcggtttgc
cgcgaggcgggactcgccttcgacctcattctcaacatctacgacaagtcgatcattgag
gtggagaaccgcccacccgcgggcgacatcgaaggcaagttcgtccgcgcgctggaaatg
ggatcgctcgatcagtcgctgatcgccgcgccggtgaaggccgccctctccatcccgctt
gaggaaacctacgtcgtcggcacgggttacggccgcgtgcgccttcctttcccgaaggag
cacatccgctcggaaatcctctgccacgggctcggcgcgcacattatgtatccgcgaacc
cgcaccgtgctcgacatcggcggacaggatacgaagggcatccaggtggatcctgcgggt
atcgtcgagaacttccagatgaacgaccgctgtgcggcgggctgcgggcgctacctcggc
tatatcgcggacgagatgaacatggggctgcaggaactcgggccgctcgccatgcagtcg
acgaagcaggtgcgcatcaactccacctgcaccgtgttcgcaggcgccgagcttcgcgac
cgcctcgcgcttggcgagaagcgcgaggacatcctcgcggggctgcaccgggcgatcatc
ctgcgcgccatgtcgatcctgtcgcgagccggtggcgtgaaggaccagttcaccttcacc
ggtggcgtcgcgaagaatgaggctgcggtgcgcgaactgcggaagctcatcaaggaaaac
tacggcgacgtgcagatcaacatcaatccggactccatctacaccggggcgcttggcggc
gcggcctttgccgtgcgcgcggtcctgaactga

DBGET integrated database retrieval system