KEGG   Rhodomicrobium vannielii: Rvan_0365Help
Entry
Rvan_0365         CDS       T01353                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00010  Glycolysis / Gluconeogenesis
rva00051  Fructose and mannose metabolism
rva00562  Inositol phosphate metabolism
rva00710  Carbon fixation in photosynthetic organisms
rva01100  Metabolic pathways
rva01110  Biosynthesis of secondary metabolites
rva01120  Microbial metabolism in diverse environments
rva01130  Biosynthesis of antibiotics
rva01200  Carbon metabolism
rva01230  Biosynthesis of amino acids
Module
rva_M00002  Glycolysis, core module involving three-carbon compounds
rva_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rvan_0365
   00051 Fructose and mannose metabolism
    Rvan_0365
   00562 Inositol phosphate metabolism
    Rvan_0365
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rvan_0365
Enzymes [BR:rva01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rvan_0365
Exosome [BR:rva04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rvan_0365
  Exosomal proteins of bladder cancer cells
   Rvan_0365
  Exosomal proteins of melanoma cells
   Rvan_0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADP69651
UniProt: E3I7N5
Position
complement(429103..429885)
Genome map
AA seq 260 aa AA seqDB search
MSGPKLYVAGNWKMNGLRPDLTQIQAIRDGVASVENAPDVTVFPPATLLHAASQIVEGSL
VEIGAQDCHVGEKGPFTGDLSALMLKDSGATTVILGHSERRAEHGETSREVRAKAATALR
AGIKIVVCIGETRGEHVRGLTASVCRRQLADSLPDESTPETTIVAYEPVWAIGSGVSPTT
EQITAVHEIVRGCLKDRFRETSGMRWRVLYGGSVSPANAASTFDSPEVDGVLVGGASLKA
ATFLEIITAAARASERRSAR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaccgaagctttatgtcgcaggcaattggaagatgaacggcctgcggcccgac
ctcacgcagatacaggccatccgcgacggcgtcgcttccgtggagaacgctcccgacgta
acggtttttccgcccgcgacgcttctgcatgccgcatcccagatcgtcgagggctcgctg
gtcgagatcggcgcgcaggattgccatgtcggcgagaaaggcccgttcacgggcgacctc
tcggcgctgatgctgaaggattctggcgcaacgaccgtcatcctcggccacagcgagcgt
cgcgccgaacatggcgagacgagccgcgaagtgcgcgcgaaggccgcgaccgcgctccgc
gccggcatcaagatcgtcgtctgcatcggcgagacgcgcggtgagcacgtccgtggcctg
accgccagcgtttgccgccgccagctcgcggacagcctgccggacgaatcgacgcccgag
accaccatcgtcgcctatgaacccgtatgggccatcggctcgggcgtgtcgccaacgacg
gaacagattacggccgtccacgaaatcgtgcgcggctgtctgaaggaccggtttcgtgag
acgagcggcatgcgctggcgtgtcctttacggcggctcggtcagccccgcgaatgccgca
tcgactttcgatagccccgaggtggacggcgtgctggtcggcggagcgagtctcaaggcg
gcgacgttccttgaaatcataacggcggcggcacgcgcatcggaaaggcgctcggcgcgt
tga

DBGET integrated database retrieval system